SEPT3 monoclonal antibody (M03), clone 4D8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SEPT3.
Immunogen
SEPT3 (NP_663786, 236 a.a. ~ 345 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
TENDKIRQESMPFAVVGSDKEYQVNGKRVLGRKTPWGIIEVENLNHCEFALLRDFVIRTHLQDLKEVTHNIHYETYRAKRLNDNGGLPPGEGLLGTVLPPVPATPCPTAE
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (99); Rat (98)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
SEPT3 monoclonal antibody (M03), clone 4D8. Western Blot analysis of SEPT3 expression in Raw 264.7 ( Cat # L024V1 ).Western Blot (Cell lysate)
SEPT3 monoclonal antibody (M03), clone 4D8 Western Blot analysis of SEPT3 expression in Jurkat ( Cat # L017V1 ).Western Blot (Cell lysate)
SEPT3 monoclonal antibody (M03), clone 4D8. Western Blot analysis of SEPT3 expression in PC-12 ( Cat # L012V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SEPT3 is approximately 0.1ng/ml as a capture antibody.ELISA
-
Gene Info — SEPT3
Entrez GeneID
55964GeneBank Accession#
NM_145733Protein Accession#
NP_663786Gene Name
SEPT3
Gene Alias
MGC133218, SEP3, bK250D10.3
Gene Description
septin 3
Omim ID
608314Gene Ontology
HyperlinkGene Summary
This gene belongs to the septin family of GTPases. Members of this family are required for cytokinesis. Expression is upregulated by retinoic acid in a human teratocarcinoma cell line. The specific function of this gene has not been determined. Alternative splicing of this gene results in two transcript variants encoding different isoforms. [provided by RefSeq
Other Designations
OTTHUMP00000028742|neuronal-specific septin 3
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com