HDAC8 monoclonal antibody (M07), clone 2F4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of HDAC8 expression in transfected 293T cell line by HDAC8 monoclonal antibody (M07), clone 2F4.
Lane 1: HDAC8 transfected lysate(41.8 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of HDAC8 transfected lysate using anti-HDAC8 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with HDAC8 MaxPab rabbit polyclonal antibody.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged HDAC8 is 0.3 ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant HDAC8.
Immunogen
HDAC8 (NP_060956.1, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MEEPEEPADSGQSLVPVYIYSPEYVSMCDSLAKIPKRASMVHSLIEAYALHKQMRIVKPKVASMEEMATFHTDAYLQHLQKVSQEGDDDHPDSIEYGLGY
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (96)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of HDAC8 expression in transfected 293T cell line by HDAC8 monoclonal antibody (M07), clone 2F4.
Lane 1: HDAC8 transfected lysate(41.8 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunoprecipitation
Immunoprecipitation of HDAC8 transfected lysate using anti-HDAC8 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with HDAC8 MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged HDAC8 is 0.3 ng/ml as a capture antibody.ELISA
-
Gene Info — HDAC8
Entrez GeneID
55869GeneBank Accession#
NM_018486Protein Accession#
NP_060956.1Gene Name
HDAC8
Gene Alias
HDACL1, RPD3
Gene Description
histone deacetylase 8
Omim ID
300269Gene Ontology
HyperlinkGene Summary
Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene belongs to class I of the histone deacetylase/acuc/apha family. It has histone deacetylase activity and represses transcription when tethered to a promoter. [provided by RefSeq
Other Designations
histone deacetylase-like 1
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com