RHOT1 monoclonal antibody (M01), clone 4H4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant RHOT1.
Immunogen
RHOT1 (NP_060777, 483 a.a. ~ 580 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
TEAEIICDVVCLVYDVSNPKSFEYCARIFKQHFMDSRIPCLIVAAKSDLHEVKQEYSISPTDFCRKHKMPPPQAFTCNTADAPSKDIFVKLTTMAMYP
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (98); Rat (91)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.52 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
RHOT1 monoclonal antibody (M01), clone 4H4 Western Blot analysis of RHOT1 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RHOT1 is approximately 0.3ng/ml as a capture antibody.ELISA
-
Gene Info — RHOT1
Entrez GeneID
55288GeneBank Accession#
NM_018307Protein Accession#
NP_060777Gene Name
RHOT1
Gene Alias
ARHT1, FLJ11040, FLJ12633, MIRO-1
Gene Description
ras homolog gene family, member T1
Gene Ontology
HyperlinkGene Summary
O
Other Designations
mitochondrial Rho 1|rac-GTP binding protein-like protein
-
Interactome
-
Disease
-
Publication Reference
-
ARF1 prevents aberrant type I interferon induction by regulating STING activation and recycling.
Maximilian Hirschenberger, Alice Lepelley, Ulrich Rupp, Susanne Klute, Victoria Hunszinger, Lennart Koepke, Veronika Merold, Blaise Didry-Barca, Fanny Wondany, Tim Bergner, Tatiana Moreau, Mathieu P Rodero, Reinhild Rösler, Sebastian Wiese, Stefano Volpi, Marco Gattorno, Riccardo Papa, Sally-Ann Lynch, Marte G Haug, Gunnar Houge, Kristen M Wigby, Jessica Sprague, Jerica Lenberg, Clarissa Read, Paul Walther, Jens Michaelis, Frank Kirchhoff, Carina C de Oliveira Mann, Yanick J Crow, Konstantin M J
Nature Communications 2023 Nov; 14(1):6770.
Application:WB, Human, HEK293T cells.
-
VPS13D bridges the ER to mitochondria and peroxisomes via Miro.
Andrés Guillén-Samander, Marianna Leonzino, Michael G Hanna, Ni Tang, Hongying Shen, Pietro De Camilli.
The Journal of Cell Biology 2021 May; 220(5):e202010004.
Application:WB-Tr, Human, HeLa cells.
-
Brain-Derived Neurotrophic Factor (BDNF)-Induced Mitochondrial Motility Arrest and Presynaptic Docking Contribute to BDNF-Enhanced Synaptic Transmission.
Su B, Ji YS, Sun XL, Liu XH, Chen ZY.
The Journal of Biological Chemistry 2014 Jan; 289(3):1213.
Application:WB-Ti, Rat, Neurons.
-
GTPase of the immune-associated nucleotide-binding protein 5 (GIMAP5) regulates calcium influx in T-lymphocytes by promoting mitochondrial calcium accumulation.
Chen XL, Serrano D, Mayhue M, Wieden HJ, Stankova J, Boulay G, Ilangumaran S, Ramanathan S.
The Biochemical Journal 2013 Jan; 449(2):353.
Application:IF, Human, HEK 293, HeLa cells.
-
N-acetylglucosamine transferase is an integral component of a kinesin-directed mitochondrial trafficking complex.
Pozo KB, Stephenson FA.
Biochimica et Biophysica Acta 2011 Jan; 1813(1):269.
Application:WB-Tr, Human, HEK 293 cells.
-
GTPase dependent recruitment of Grif-1 by Miro1 regulates mitochondrial trafficking in hippocampal neurons.
Macaskill AF, Brickley K, Stephenson FA, Kittler JT.
Molecular and Cellular Neurosciences 2008 Dec; 40(3):301.
Application:IF, Human, DIV 10 neurons, HEK 293 cells.
-
ARF1 prevents aberrant type I interferon induction by regulating STING activation and recycling.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com