PHF10 MaxPab rabbit polyclonal antibody (D01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
PHF10 MaxPab rabbit polyclonal antibody. Western Blot analysis of PHF10 expression in human colon.
Immunoprecipitation
Immunoprecipitation of PHF10 transfected lysate using anti-PHF10 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with PHF10 purified MaxPab mouse polyclonal antibody (B01P) (H00055274-B01P).
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human PHF10 protein.
Immunogen
PHF10 (NP_060758.1, 1 a.a. ~ 410 a.a) full-length human protein.
Sequence
MLQEQVSEYLGVTSFKRKYPDLERRDLSHKEKLYLRELNVITETQCTLGLTALRSDEVIDLMIKEYPAKHAEYSVILQEKERQRITDHYKEYSQMQQQNTQKVEASKVPEYIKKAAKKAAEFNSNLNRERMEERRAYFDLQTHVIQVPQGKYKVLPTERTKVSSYPVALIPGQFQEYYKRYSPDELRYLPLNTALYEPPLDPELPALDSDGDSDDGEDGRGDEKRKNKGTSDSSSGNVSEGESPPDSQEDSFQGRQKSKDKAATPRKDGPKRSVLSKSVPGYKPKVIPNAICGICLKGKESNKKGKAESLIHCSQCENSGHPSCLDMTMELVSMIKTYPWQCMECKTCIICGQPHHEEEMMFCDMCDRGYHTFCVGLGAIPSGRWICDCCQRAPPTPRKVGRRGKNSKEG
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Mouse (97)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
No additive
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
PHF10 MaxPab rabbit polyclonal antibody. Western Blot analysis of PHF10 expression in human colon.Immunoprecipitation
Immunoprecipitation of PHF10 transfected lysate using anti-PHF10 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with PHF10 purified MaxPab mouse polyclonal antibody (B01P) (H00055274-B01P). -
Gene Info — PHF10
Entrez GeneID
55274GeneBank Accession#
NM_018288.2Protein Accession#
NP_060758.1Gene Name
PHF10
Gene Alias
FLJ10975, MGC111009, XAP135
Gene Description
PHD finger protein 10
Gene Ontology
HyperlinkGene Summary
This gene contains a predicted ORF that encodes a protein with two zinc finger domains. The function of the encoded protein is not known. Sequence analysis suggests that multiple alternatively spliced transcript variants are derived from this gene but the full-length nature of only two of them is known. These two splice variants encode different isoforms. A pseudogene for this gene is located on Xq28. [provided by RefSeq
Other Designations
OTTHUMP00000017671|PHD finger protein 10, isoform a|PHD zinc finger protein XAP135
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com