C20orf20 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of C20orf20 expression in transfected 293T cell line (H00055257-T01) by C20orf20 MaxPab polyclonal antibody.
Lane 1: C20orf20 transfected lysate(22.44 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of purified MaxPab antibody to C20orf20 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml]
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to C20orf20 on HeLa cell. [antibody concentration 10 ug/ml]
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human C20orf20 protein.
Immunogen
C20orf20 (NP_060740.1, 1 a.a. ~ 204 a.a) full-length human protein.
Sequence
MGEAEVGGGGAAGDKGPGEAATSPAEETVVWSPEVEVCLFHAMLGHKPVGVNRHFHMICIRDKFSQNIGRQVPSKVIWDHLSTMYDMQALHESEILPFPNPERNFVLPEEIIQEVREGKVMIEEEMKEEMKEDVDPHNGADDVFSSSGSLGKASEKSSKDKEKNSSDLGCKEGADKRKRSRVTDKVLTANSNPSSPSAAKRRRT
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (96)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of C20orf20 expression in transfected 293T cell line (H00055257-T01) by C20orf20 MaxPab polyclonal antibody.
Lane 1: C20orf20 transfected lysate(22.44 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of purified MaxPab antibody to C20orf20 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml]Immunofluorescence
Immunofluorescence of purified MaxPab antibody to C20orf20 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — C20orf20
Entrez GeneID
55257GeneBank Accession#
NM_018270.3Protein Accession#
NP_060740.1Gene Name
C20orf20
Gene Alias
Eaf7, FLJ10914, MRG15BP, MRGBP, URCC4
Gene Description
chromosome 20 open reading frame 20
Omim ID
611157Gene Ontology
HyperlinkOther Designations
MRG(MORF4-related gene)-binding protein|MRG-binding protein|OTTHUMP00000031512
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com