FANCI MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of FANCI expression in transfected 293T cell line (H00055215-T04) by FANCI MaxPab polyclonal antibody.
Lane 1: FANCI transfected lysate(8.14 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human FANCI protein.
Immunogen
FANCI (AAH04277, 1 a.a. ~ 73 a.a) full-length human protein.
Sequence
MFKDVPLTAEEVEFVVEKALSMFSKMNLQEIPPLVYQLLVLSSKGSRKSVLEGIIAFFSALDKQHNEEQSGDE
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (78)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of FANCI expression in transfected 293T cell line (H00055215-T04) by FANCI MaxPab polyclonal antibody.
Lane 1: FANCI transfected lysate(8.14 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — FANCI
Entrez GeneID
55215GeneBank Accession#
BC004277Protein Accession#
AAH04277Gene Name
FANCI
Gene Alias
FLJ10719, KIAA1794
Gene Description
Fanconi anemia, complementation group I
Gene Ontology
HyperlinkGene Summary
The Fanconi anemia complementation group (FANC) currently includes FANCA, FANCB, FANCC, FANCD1 (also called BRCA2), FANCD2, FANCE, FANCF, FANCG, FANCI, FANCJ (also called BRIP1), FANCL, FANCM and FANCN (also called PALB2). The previously defined group FANCH is the same as FANCA. Fanconi anemia is a genetically heterogeneous recessive disorder characterized by cytogenetic instability, hypersensitivity to DNA crosslinking agents, increased chromosomal breakage, and defective DNA repair. The members of the Fanconi anemia complementation group do not share sequence similarity; they are related by their assembly into a common nuclear protein complex. This gene encodes the protein for complementation group I. Alternative splicing results in two transcript variants encoding different isoforms. [provided by RefSeq
Other Designations
-
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com