RPRD1A monoclonal antibody (M01), clone 1B8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant RPRD1A.
Immunogen
RPRD1A (NP_060640, 76 a.a. ~ 170 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
EFTKDFAPVIVEAFKHVSSETDESCKKHLGRVLSIWEERSVYENDVLEQLKQALYGDKKPRKRTYEQIKVDENENCSSLGSPSEPPQTLDLVRAL
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (98); Rat (98)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.19 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
RPRD1A monoclonal antibody (M01), clone 1B8. Western Blot analysis of RPRD1A expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Cell lysate)
RPRD1A monoclonal antibody (M01), clone 1B8. Western Blot analysis of RPRD1A expression in PC-12 ( Cat # L012V1 ).Western Blot (Cell lysate)
RPRD1A monoclonal antibody (M01), clone 1B8 Western Blot analysis of RPRD1A expression in A-431 ( Cat # L015V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to RPRD1A on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RPRD1A is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — RPRD1A
Entrez GeneID
55197GeneBank Accession#
NM_018170Protein Accession#
NP_060640Gene Name
RPRD1A
Gene Alias
FLJ10656, HsT3101, MGC19513, P15RS
Gene Description
regulation of nuclear pre-mRNA domain containing 1A
Omim ID
610347Gene Ontology
HyperlinkGene Summary
P15RS is upregulated in cells overexpressing cyclin-dependent kinase inhibitor p15(INK4b) (CDKN2B; MIM 600431) and may have a role in cell cycle regulation (Liu et al., 2002 [PubMed 12470661]).[supplied by OMIM
Other Designations
Cyclin-dependent kinase inhibitor 2B-related protein (p15INK4B-related protein)|cyclin-dependent kinase 2B-inhibitor-related protein
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com