TAPBPL monoclonal antibody (M02), clone 6E3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
TAPBPL monoclonal antibody (M02), clone 6E3 Western Blot analysis of TAPBPL expression in A-431 ( Cat # L015V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of TAPBPL expression in transfected 293T cell line by TAPBPL monoclonal antibody (M02), clone 6E3.
Lane 1: TAPBPL transfected lysate(50.2 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TAPBPL is approximately 0.03ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.63 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant TAPBPL.
Immunogen
TAPBPL (NP_060479, 23 a.a. ~ 121 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
PHPAEGQWRAVDVVLDCFLVKDGAHRGALASSEDRARASLVLKQVPVLDDGSLEDFTDFQGGTLAQDDPPIIFEASVDLVQIPQAEALLHADCSGKEVT
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
TAPBPL monoclonal antibody (M02), clone 6E3 Western Blot analysis of TAPBPL expression in A-431 ( Cat # L015V1 ).Western Blot (Transfected lysate)
Western Blot analysis of TAPBPL expression in transfected 293T cell line by TAPBPL monoclonal antibody (M02), clone 6E3.
Lane 1: TAPBPL transfected lysate(50.2 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TAPBPL is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — TAPBPL
Entrez GeneID
55080GeneBank Accession#
NM_018009Protein Accession#
NP_060479Gene Name
TAPBPL
Gene Alias
FLJ10143, TAPBP-R, TAPBPR
Gene Description
TAP binding protein-like
Omim ID
607081Gene Ontology
HyperlinkGene Summary
Tapasin, or TAPBP (MIM 601962), is a member of the variable-constant Ig superfamily that links major histocompatibility complex (MHC) class I molecules to the transporter associated with antigen processing (TAP; see MIM 170260) in the endoplasmic reticulum (ER). The TAPBP gene is located near the MHC complex on chromosome 6p21.3. TAPBPL is a member of the Ig superfamily that is localized on chromosome 12p13.3, a region somewhat paralogous to the MHC.[supplied by OMIM
Other Designations
TAP binding protein related
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com