USP47 monoclonal antibody (M01), clone 5F9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
USP47 monoclonal antibody (M01), clone 5F9 Western Blot analysis of USP47 expression in HeLa ( Cat # L013V1 ).
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged USP47 is approximately 0.3ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to USP47 on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (36.63 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant USP47.
Immunogen
USP47 (NP_060414, 203 a.a. ~ 301 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
TEQADLINELYQGKLKDYVRCLECGYEGWRIDTYLDIPLVIRPYGSSQAFASVEEALHAFIQPEILDGPNQYFCERCKKKCDARKGLRFLHFPYLLTLQ
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (92); Rat (93)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
USP47 monoclonal antibody (M01), clone 5F9 Western Blot analysis of USP47 expression in HeLa ( Cat # L013V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged USP47 is approximately 0.3ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to USP47 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — USP47
Entrez GeneID
55031GeneBank Accession#
NM_017944Protein Accession#
NP_060414Gene Name
USP47
Gene Alias
DKFZp686C13257, FLJ20727, TRFP
Gene Description
ubiquitin specific peptidase 47
Gene Ontology
HyperlinkOther Designations
Trf (TATA binding protein-related factor)-proximal homolog|ubiquitin specific protease 47
-
Interactome
-
Publication Reference
-
USP47 and C Terminus of Hsp70-Interacting Protein (CHIP) Antagonistically Regulate Katanin-p60-Mediated Axonal Growth.
Yang SW, Oh KH, Park E, Chang HM, Park JM, Seong MW, Ka SH, Song WK, Park DE, Baas PW, Jeon YJ, Chung CH.
The Journal of Neuroscience 2013 Jul; 33(31):12728.
Application：IP, WB-Tr, Human, Rat, HEK 293T cells, Rat hippocampal neurons.
-
The ubiquitin-specific protease USP47 is a novel beta-TRCP interactor regulating cell survival.
Peschiaroli A, Skaar JR, Pagano M, Melino G.
Oncogene 2010 Mar; 29(9):1384.
Application：WB-Ce, WB-Tr, Human, Mouse, MEFs, HEK 293T, HeLa cells, Lungs, U-2 OS cells.
-
USP47 and C Terminus of Hsp70-Interacting Protein (CHIP) Antagonistically Regulate Katanin-p60-Mediated Axonal Growth.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com