OCIAD1 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
OCIAD1 MaxPab polyclonal antibody. Western Blot analysis of OCIAD1 expression in human pancreas.
Western Blot (Transfected lysate)
Western Blot analysis of OCIAD1 expression in transfected 293T cell line (H00054940-T01) by OCIAD1 MaxPab polyclonal antibody.
Lane 1: OCIAD1 transfected lysate(27.06 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human OCIAD1 protein.
Immunogen
OCIAD1 (AAH03409, 1 a.a. ~ 245 a.a) full-length human protein.
Sequence
MNGRADFREPNAEVPRPIPHIGPDYIPTEEERRVFAECNDESFWFRSVPLAATSMLITQGLISKGILSSHPKYGSIPKLILACIMGYFAGKLSYVKTCQEKFKKLENSPLGEALRSGQARRSSPPGHYYQKSKYDSSVSGQSSFVTSPAADNIEMLPHYEPIPFSSSMNESAPTGITDHIVQGPDPNLEESPKRKNITYEELRNKNRESYEVSLTQKTDPSVRPMHERVPKKEVKVNKYGDTWDE
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (85); Rat (85)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
OCIAD1 MaxPab polyclonal antibody. Western Blot analysis of OCIAD1 expression in human pancreas.Western Blot (Transfected lysate)
Western Blot analysis of OCIAD1 expression in transfected 293T cell line (H00054940-T01) by OCIAD1 MaxPab polyclonal antibody.
Lane 1: OCIAD1 transfected lysate(27.06 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — OCIAD1
-
Interactome
-
Publication Reference
-
The influence of neural cell adhesion molecule isoform 140 on the metastasis of thyroid carcinoma.
Yang AH, Chau YP, Lee CH, Chen JY, Chen JY, Ke CC, Liu RS.
Clinical & Experimental Metastasis 2013 Mar; 30(3):299.
Application：WB, Mouse , ARO cells.
-
Expression of NCAM and OCIAD1 in well-differentiated thyroid carcinoma: correlation with the risk of distant metastasis.
Yang AH, Chen JY, Lee CH, Chen JY.
Journal of Clinical Pathology 2012 Mar; 65(3):206.
Application：IHC-P, WB-Ti, Human, Thyroid, Thyroid carcinoma.
-
The influence of neural cell adhesion molecule isoform 140 on the metastasis of thyroid carcinoma.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com