FNBP1L monoclonal antibody (M01), clone 1E6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
FNBP1L monoclonal antibody (M01), clone 1E6. Western Blot analysis of FNBP1L expression in HepG2.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged FNBP1L is 1 ng/ml as a capture antibody.
Western Blot detection against Immunogen (32.89 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant FNBP1L.
Immunogen
FNBP1L (NP_060207.2, 175 a.a. ~ 239 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
LNLRTHMADENKNEYAAQLQNFNGEQHKHFYVVIPQIYKQLQEMDERRTIKLSECYRGFADSERK
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (75); Rat (77)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (32.89 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
FNBP1L monoclonal antibody (M01), clone 1E6. Western Blot analysis of FNBP1L expression in HepG2.Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged FNBP1L is 1 ng/ml as a capture antibody.ELISA
-
Gene Info — FNBP1L
Entrez GeneID
54874GeneBank Accession#
NM_017737Protein Accession#
NP_060207.2Gene Name
FNBP1L
Gene Alias
C1orf39, TOCA1
Gene Description
formin binding protein 1-like
Omim ID
608848Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene binds to both CDC42 and N-WASP. This protein promotes CDC42-induced actin polymerization by activating the N-WASP-WIP complex and, therefore, is involved in a pathway that links cell surface signals to the actin cytoskeleton. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq
Other Designations
transducer of Cdc42-dependent actin assembly 1
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com