SIAE purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human SIAE protein.
Immunogen
SIAE (NP_733746.1, 1 a.a. ~ 523 a.a) full-length human protein.
Sequence
MVAPGLVLGLVLPLILWADRSAGIGFRFASYINNDMVLQKEPAGAVIWGFGTPGATVTVTLRQGQETIMKKVTSVKAHSDTWMVVLDPMKPGGPFEVMAQQTLEKINFTLRVHDVLFGDVWLCSGQSNMQMTVLQIFNATRELSNTAAYQSVRILSVSPIQAEQELEDLVAVDLQWSKPTSENLGHGYFKYMSAVCWLFGRHLYDTLQYPIGLIASSWGGTPIEAWSSGRSLKACGVPKQGSIPYDSVTGPSKHSVLWNAMIHPLCNMTLKGVVWYQGESNINYNTDLYNCTFPALIEDWRETFHRGSQGQTERFFPFGLVQLSSDLSKKSSDDGFPQIRWHQTADFGYVPNPKMPNTFMAVAMDLCDRDSPFGSIHPRDKQTVAYRLHLGARALAYGEKNLTFEGPLPEKIELLAHKGLLNLTYYQQIQVQKKDNKIFEISCCSDHRCKWLPASMNTVSTQSLTLAIDSCHGTVVALRYAWTTWPCEYKQCPLYHPSSALPAPPFIAFITDQGPGHQSNVAK
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (76); Rat (75)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
SIAE MaxPab polyclonal antibody. Western Blot analysis of SIAE expression in human colon.Western Blot (Transfected lysate)
Western Blot analysis of SIAE expression in transfected 293T cell line (H00054414-T01) by SIAE MaxPab polyclonal antibody.
Lane1:SIAE transfected lysate(57.53 KDa).
Lane2:Non-transfected lysate.
-
Gene Info — SIAE
Entrez GeneID
54414GeneBank Accession#
NM_170601.3Protein Accession#
NP_733746.1Gene Name
SIAE
Gene Alias
CSE-C, LSE, MGC87009, YSG2
Gene Description
sialic acid acetylesterase
Omim ID
610079Gene Ontology
HyperlinkGene Summary
Sialic acids are acidic 9-carbon sugars typically found at the nonreducing end of sugar chains. They are frequently modified by 9-O-acetylation, and this modification is removed by sialic acid acetylesterases. SIAE appears to encode both lysosomal and cytosolic sialic acid acetylesterase isoforms (LSE and CSE, respectively) (Takematsu et al., 1999 [PubMed 10464298]).[supplied by OMIM
Other Designations
Ysg2 homolog|cytosolic sialic acid 9-O-acetylesterase homolog|sialic acid-specific acetylesterase II
-
Interactome
-
Disease
-
Publication Reference
-
Effects of sodium thiosulfate (Na2S2O3) during resuscitation from hemorrhagic shock in swine with preexisting atherosclerosis.
Datzmann T, Hoffmann A, McCook O, Merz T, Wachter U, Preuss J, Vettorazzi S, Calzia E, Gröger M, Kohn F, Schmid A, Denoix N, Radermacher P, Wepler M.
Pharmacological Research 2019 Nov; 151:104536.
Application:IHC, Mouse, Mouse lung.
-
Induction of cystathionine gamma-lyase expression and metallothionein-1 S-sulfhydration alleviate cadmium-induced cell death in myoblast cells.
Zhang Y, Ali A, Jin Z, Pei Y, Yang G.
Ecotoxicology and Environmental Safety 2019 Sep; 179:222.
Application:WB-Tr, Mouse, C2C12 cells.
-
Cystathionine gamma-lyase/hydrogen sulfide system is essential for adipogenesis and fat mass accumulation in mice.
Yang G, Ju Y, Fu M, Zhang Y, Pei Y, Racine M, Baath S, Merritt TJS, Wang R, Wu L.
Biochimica et Biophysica Acta 2017 Nov; 1863(2):165.
Application:WB-Ce, WB-Ti, Mouse, 3T3-L1, Mouse liver, muscle and fat tissue.
-
H2S protects lipopolysaccharide-induced inflammation by blocking NFκB transactivation in endothelial cells.
Bourque C, Zhang Y, Fu M, Racine M, Greasley A, Pei Y, Wu L, Wang R, Yang G.
Toxicology and Applied Pharmacology 2017 Nov; 338:20.
Application:WB-Ce, WB-Tr, Human, Mouse, HUVEC, Mouse aorta tissues.
-
Hydrogen Sulfide Attenuates Atherosclerosis in a Partially Ligated Carotid Artery Mouse model via Regulating Angiotensin Converting Enzyme 2 Expression.
Lin Y, Zeng H, Gao L, Gu T, Wang C, Zhang H.
Frontiers in Physiology 2017 Oct; 8:782.
Application:WB-Ti, Mouse, Mouse artery.
-
Induction of a Torpor-Like State by 5'-AMP Does Not Depend on H2S Production.
Dugbartey GJ, Bouma HR, Strijkstra AM, Boerema AS, Henning RH.
PLoS One 2015 Aug; 10(8):e0136113.
Application:WB-Ti, Mouse, Frozen kidney tissue samples.
-
Effects of sodium thiosulfate (Na2S2O3) during resuscitation from hemorrhagic shock in swine with preexisting atherosclerosis.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com