NANS purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
NANS MaxPab polyclonal antibody. Western Blot analysis of NANS expression in human pancreas.
Western Blot (Transfected lysate)
Western Blot analysis of NANS expression in transfected 293T cell line (H00054187-T01) by NANS MaxPab polyclonal antibody.
Lane 1: NANS transfected lysate(39.49 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human NANS protein.
Immunogen
NANS (NP_061819.2, 1 a.a. ~ 359 a.a) full-length human protein.
Sequence
MPLELELCPGRWVGGQHPCFIIAEIGQNHQGDLDVAKRMIRMAKECGADCAKFQKSELEFKFNRKALERPYTSKHSWGKTYGEHKRHLEFSHDQYRELQRYAEEVGIFFTASGMDEMAVEFLHELNVPFFKVGSGDTNNFPYLEKTAKKGRPMVISSGMQSMDTMKQVYQIVKPLNPNFCFLQCTSAYPLQPEDVNLRVISEYQKLFPDIPIGYSGHETGIAISVAAVALGAKVLERHITLDKTWKGSDHSASLEPGELAELVRSVRLVERALGSPTKQLLPCEMACNEKLGKSVVAKVKIPEGTILTMDMLTVKVGEPKGYPPEDIFNLVGKKVLVTVEEDDTIMEELVDNHGKKIKS
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (94); Rat (94)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
NANS MaxPab polyclonal antibody. Western Blot analysis of NANS expression in human pancreas.Western Blot (Transfected lysate)
Western Blot analysis of NANS expression in transfected 293T cell line (H00054187-T01) by NANS MaxPab polyclonal antibody.
Lane 1: NANS transfected lysate(39.49 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — NANS
Entrez GeneID
54187GeneBank Accession#
NM_018946.2Protein Accession#
NP_061819.2Gene Name
NANS
Gene Alias
SAS
Gene Description
N-acetylneuraminic acid synthase
Omim ID
605202Gene Ontology
HyperlinkGene Summary
This gene encodes an enzyme that functions in the biosynthetic pathways of sialic acids. In vitro, the encoded protein uses N-acetylmannosamine 6-phosphate and mannose 6-phosphate as substrates to generate phosphorylated forms of N-acetylneuraminic acid (Neu5Ac) and 2-keto-3-deoxy-D-glycero-D-galacto-nononic acid (KDN), respectively; however, it exhibits much higher activity toward the Neu5Ac phosphate product. In insect cells, expression of this gene results in Neu5Ac and KDN production. This gene is related to the E. coli sialic acid synthase gene neuB, and it can partially restore sialic acid synthase activity in an E. coli neuB-negative mutant. [provided by RefSeq
Other Designations
N-acetylneuraminic acid phosphate synthase|OTTHUMP00000021769|sialic acid phosphate synthase|sialic acid synthase
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com