RIPK4 monoclonal antibody (M01), clone 2G3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant RIPK4.
Immunogen
RIPK4 (NP_065690, 675 a.a. ~ 784 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
HLAARNGHLATVKLLVEEKADVLARGPLNQTALHLAAAHGHSEVVEELVSADVIDLFDEQGLSALHLAAQGRHAQTVETLLRHGAHINLQSLKFQGGHGPAATLLRRSKT
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (90); Rat (89)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
RIPK4 monoclonal antibody (M01), clone 2G3 Western Blot analysis of RIPK4 expression in A-431 ( Cat # L015V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RIPK4 is approximately 0.3ng/ml as a capture antibody.ELISA
-
Gene Info — RIPK4
Entrez GeneID
54101GeneBank Accession#
NM_020639Protein Accession#
NP_065690Gene Name
RIPK4
Gene Alias
ANKK2, ANKRD3, DIK, MGC129992, MGC129993, PKK, RIP4
Gene Description
receptor-interacting serine-threonine kinase 4
Omim ID
605706Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a serine/threonine protein kinase that interacts with protein kinase C-delta. The encoded protein can also activate NFkappaB and is required for keratinocyte differentiation. This kinase undergoes autophosphorylation. [provided by RefSeq
Other Designations
PKC-delta-interacting protein kinase|ankyrin repeat domain 3|serine/threonine-protein kinase ANKRD3
-
Interactome
-
Disease
-
Publication Reference
-
RIPK4 activity in keratinocytes is controlled by the SCFβ-TrCP ubiquitin ligase to maintain cortical actin organization.
Tanghe G, Urwyler-Rosselet C, De Groote P, Dejardin E, De Bock PJ, Gevaert K, Vandenabeele P, Declercq W.
Cellular and Molecular Life Sciences : CMLS 2018 Feb; [Epub].
Application:WB-Ce, Human, HEK293T, A431, A549, HaCaT cells.
-
RIP4 inhibits STAT3 signaling to sustain lung adenocarcinoma differentiation.
Kopparam J, Chiffelle J, Angelino P, Piersigilli A, Zangger N, Delorenzi M, Meylan E.
Cell Death and Differentiation 2017 Oct; 24(10):1761.
Application:WB-Ce, WB-Tr, Human, Mouse, H2009 cells, M8 cells.
-
Phosphorylation of Pkp1 by RIPK4 regulates epidermal differentiation and skin tumorigenesis.
Lee P, Jiang S, Li Y, Yue J, Gou X, Chen SY, Zhao Y, Schober M, Tan M, Wu X.
The EMBO Journal 2017 May; 36(13):1963.
Application:KA, WB, Human, Mouse, HEK293T cells, Mouse skin.
-
RIP4 is a target of multiple signal transduction pathways in keratinocytes: Implications for epidermal differentiation and cutaneous wound repair.
Adams S, Munz B.
Experimental Cell Research 2010 Jan; 316(1):126.
Application:IF, IHC, Mouse, Mouse tail skin tissues.
-
RIPK4 activity in keratinocytes is controlled by the SCFβ-TrCP ubiquitin ligase to maintain cortical actin organization.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com