ZAK (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human ZAK partial ORF ( AAH01401, 1 a.a. - 120 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MSSLGASFVQIKFDDLQFFENCGGGSFGSVYRAKWISQDKEVAVKKLLKIEKEAEILSVLSHRNIIQFYGVILEPPNYGIVTEYASLGSLYDYINSNRSEEMDMDHIMTWATDVAKGMHY
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
38.83
Interspecies Antigen Sequence
Mouse (92)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — ZAK
Entrez GeneID
51776GeneBank Accession#
BC001401Protein Accession#
AAH01401Gene Name
ZAK
Gene Alias
AZK, MLK7, MLT, MLTK, MRK, mlklak
Gene Description
sterile alpha motif and leucine zipper containing kinase AZK
Omim ID
609479Gene Ontology
HyperlinkGene Summary
This gene is a member of the MAPKKK family of signal transduction molecules and encodes a protein with an N-terminal kinase catalytic domain, followed by a leucine zipper motif and a sterile-alpha motif (SAM). This magnesium-binding protein forms homodimers and is located in the cytoplasm. The protein mediates gamma radiation signaling leading to cell cycle arrest and activity of this protein plays a role in cell cycle checkpoint regulation in cells. The protein also has pro-apoptotic activity. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq
Other Designations
MLK-like mitogen-activated protein triple kinase|MLK-related kinase|cervical cancer suppressor gene 4 protein|leucine zipper- and sterile alpha motif-containing kinase|mitogen-activated protein kinase kinase kinase MLT|mixed lineage kinase 7|mixed lineage
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com