OTUD6B (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human OTUD6B full-length ORF ( NP_057107.2, 1 a.a. - 293 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MEAVLTEELDEEEQLLRRHRKEKKELQAKIQGMKNAVPKNDKKRRKQLTEDVAKLEKEMEQKHREELEQLKLTTKENKIDSVAVNISNLVLENQPPRISKAQKRREKKAALEKEREERIAEAEIENLTGARHMESEKLAQILAARQLEIKQIPSDGHCMYKAIEDQLKEKDCALTVVALRSQTAEYMQSHVEDFLPFLTNPNTGDMYTPEEFQKYCEDIVNTAAWGGQLELRALSHILQTPIEIIQADSPPIIVGEEYSKKPLILVYMRHAYGLGEHYNSVTRLVNIVTENCS
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
60.2
Interspecies Antigen Sequence
Rat (87)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — OTUD6B
Entrez GeneID
51633GeneBank Accession#
NM_016023.2Protein Accession#
NP_057107.2Gene Name
OTUD6B
Gene Alias
CGI-77, DUBA5
Gene Description
OTU domain containing 6B
Gene Ontology
HyperlinkGene Summary
Deubiquitinating enzymes (DUBs; see MIM 603478) are proteases that specifically cleave ubiquitin (MIM 191339) linkages, negating the action of ubiquitin ligases. DUBA5 belongs to a DUB subfamily characterized by an ovarian tumor (OTU) domain.[supplied by OMIM
Other Designations
-
-
Interactome
-
Publication Reference
-
Mining the pre-diagnostic antibody repertoire of TgMMTV-neu mice to identify autoantibodies useful for the early detection of human breast cancer.
Mao J, Ladd J, Gad E, Rastetter L, Johnson MM, Marzbani E, Childs JS, Lu H, Dang Y, Broussard E, Stanton SE, Hanash SM, Disis ML.
Journal of Translational Medicine 2014 May; 12:121.
Application:ELISA, Mouse, Serum.
-
Mining the pre-diagnostic antibody repertoire of TgMMTV-neu mice to identify autoantibodies useful for the early detection of human breast cancer.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com