PCQAP (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human PCQAP partial ORF ( NP_056973, 1 a.a. - 88 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MDVSGQETDWRSTAFRQKLVSQIEDAMRKAGVAHSKSSKDMESHVFLKAKTRDEYLSLVARLIIHFRDIHNKKSQASVSDPMNALQSL
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
35.42
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — MED15
Entrez GeneID
51586GeneBank Accession#
NM_015889Protein Accession#
NP_056973Gene Name
MED15
Gene Alias
ARC105, CAG7A, CTG7A, DKFZp686A2214, DKFZp762B1216, FLJ42282, FLJ42935, PCQAP, TIG-1, TIG1, TNRC7
Gene Description
mediator complex subunit 15
Omim ID
607372Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a subunit of the multiprotein complexes PC2 and ARC/DRIP and may function as a transcriptional coactivator in RNA polymerase II transcription. This gene contains stretches of trinucleotide repeats and is located in the chromosome 22 region which is deleted in DiGeorge syndrome. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
CTG repeat protein 7a|PC2 (positive cofactor 2, multiprotein complex) glutamine/Q-rich-associated protein|PC2-glutamine-rich-associated protein|TPA inducible gene-1|TPA inducible protein|activator-recruited cofactor, 105-kD|positive cofactor 2, glutamine/
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com