WBP5 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human WBP5 full-length ORF ( ABZ92330.1, 1 a.a. - 104 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MKSCQKMEGKPENESEPKHEEEPKPEEKPEEEEKLEEEAKAKGTFRERLIQSLQEFKEDIHNRHLSNEDMFREVDEIDEIRRVRNKLIVMRWKVNRNHPYPYLM
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
11.5
Interspecies Antigen Sequence
Mouse (74); Rat (80)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — WBP5
Entrez GeneID
51186GeneBank Accession#
EU446801.1Protein Accession#
ABZ92330.1Gene Name
WBP5
Gene Alias
DKFZp313K1940, TCEAL9
Gene Description
WW domain binding protein 5
Gene Ontology
HyperlinkGene Summary
The globular WW domain is composed of 38 to 40 semiconserved amino acids shared by proteins of diverse functions including structural, regulatory, and signaling proteins. The domain is involved in mediating protein-protein interactions through the binding of polyproline ligands. This gene encodes a WW domain binding protein. This gene also encodes a domain with similarity to the transcription elongation factor A, SII-related family. Alternative splicing results in multiple transcript variants encoding a single isoform. [provided by RefSeq
Other Designations
OTTHUMP00000023739|OTTHUMP00000023740|WW domain binding protein 1|pp21 homolog
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com