ANGPTL4 purified MaxPab mouse polyclonal antibody (B01P)

Catalog # H00051129-B01P

Size

Price

Stock

Quantity

Size:50 ug
Price: USD $ 335.00
Stock:
order now, ship next day
abnova-minus
abnova-plus

* The price is valid only in USA. Please select country.

Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
Images
Western Blot (Cell lysate)
Application

Western Blot (Cell lysate)

ANGPTL4 MaxPab polyclonal antibody. Western Blot analysis of ANGPTL4 expression in NIH/3T3.

Western Blot (Cell lysate)
Application

Western Blot (Cell lysate)

ANGPTL4 MaxPab polyclonal antibody. Western Blot analysis of ANGPTL4 expression in HeLa.

Western Blot (Cell lysate)
Application

Western Blot (Cell lysate)

ANGPTL4 MaxPab polyclonal antibody. Western Blot analysis of ANGPTL4 expression in RIN-m5F.

Western Blot (Transfected lysate)
Application

Western Blot (Transfected lysate)

Western Blot analysis of ANGPTL4 expression in transfected 293T cell line (H00051129-T02) by ANGPTL4 MaxPab polyclonal antibody.

Lane 1: ANGPTL4 transfected lysate(44.66 KDa).
Lane 2: Non-transfected lysate.

  • Specification

    Product Description

    Mouse polyclonal antibody raised against a full-length human ANGPTL4 protein.MaxPab Polyclonal Antibody,MaxPab Polyclonal Antibodies,MaxPab,DNA Immune,DNA Immunization,Immune Technology

    Immunogen

    ANGPTL4 (NP_647475.1, 1 a.a. ~ 406 a.a) full-length human protein.

    Sequence

    MSGAPTAGAALMLCAATAVLLSAQGGPVQSKSPRFASWDEMNVLAHGLLQLGQGLREHAERTRSQLSALERRLSACGSACQGTEGSTDLPLAPESRVDPEVLHSLQTQLKAQNSRIQQLFHKVAQQQRHLEKQHLRIQHLQSQFGLLDHKHLDHEVAKPARRKRLPEMAQPVDPAHNVSRLHRLPRDCQELFQVGERQSGLFEIQPQGSPPFLVNCKMTSDGGWTVIQRRHDGSVDFNRPWEAYKAGFGDPHGEFWLGLEKVHSITGDRNSRLAVQLRDWDGNAELLQFSVHLGGEDTAYSLQLTAPVAGQLGATTVPPSGLSVPFSTWDQDHDLRRDKNCAKSLSGGWWFGTCSHSNLNGQYFRSIPQQRQKLKKGIFWKTWRGRYYPLQATTMLIQPMAAEAAS

    Host

    Mouse

    Reactivity

    Human, Mouse, Rat

    Interspecies Antigen Sequence

    Mouse (75); Rat (76)

    Quality Control Testing

    Antibody reactive against mammalian transfected lysate.

    Storage Buffer

    In 1x PBS, pH 7.4

    Storage Instruction

    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

  • Applications

    Western Blot (Cell lysate)

    ANGPTL4 MaxPab polyclonal antibody. Western Blot analysis of ANGPTL4 expression in NIH/3T3.

    Western Blot (Cell lysate)

    ANGPTL4 MaxPab polyclonal antibody. Western Blot analysis of ANGPTL4 expression in HeLa.

    Western Blot (Cell lysate)

    ANGPTL4 MaxPab polyclonal antibody. Western Blot analysis of ANGPTL4 expression in RIN-m5F.

    Western Blot (Transfected lysate)

    Western Blot analysis of ANGPTL4 expression in transfected 293T cell line (H00051129-T02) by ANGPTL4 MaxPab polyclonal antibody.

    Lane 1: ANGPTL4 transfected lysate(44.66 KDa).
    Lane 2: Non-transfected lysate.
  • Gene Info — ANGPTL4

    Entrez GeneID

    51129

    GeneBank Accession#

    NM_139314

    Protein Accession#

    NP_647475.1

    Gene Name

    ANGPTL4

    Gene Alias

    ANGPTL2, ARP4, FIAF, HFARP, NL2, PGAR, pp1158

    Gene Description

    angiopoietin-like 4

    Omim ID

    605910

    Gene Ontology

    Hyperlink

    Gene Summary

    This gene is a member of the angiopoietin/angiopoietin-like gene family and encodes a glycosylated, secreted protein with a fibrinogen C-terminal domain. This gene is induced under hypoxic conditions in endothelial cells and is the target of peroxisome proliferation activators. The encoded protein is a serum hormone directly involved in regulating glucose homeostasis, lipid metabolism, and insulin sensitivity and also acts as an apoptosis survival factor for vascular endothelial cells. The encoded protein may play a role in several cancers and it also has been shown to prevent the metastatic process by inhibiting vascular activity as well as tumor cell motility and invasiveness. Decreased expression of this protein has been associated with type 2 diabetes. Alternatively spliced transcript variants encoding different isoforms have been described. This gene was previously referred to as ANGPTL2 but has been renamed ANGPTL4. [provided by RefSeq

    Other Designations

    PPARG angiopoietin related protein|angiopoietin-like 4 protein|angiopoietin-related protein 4|fasting-induced adipose factor|hepatic angiopoietin-related protein|hepatic fibrinogen/angiopoietin-related protein|peroxisome proliferator-activated receptor (P

  • Interactome
  • Pathway
  • Disease
  • Publication Reference
Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
4 Products to Compare
Remove All