SPG3A monoclonal antibody (M03), clone 1B9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SPG3A.
Immunogen
SPG3A (NP_056999, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MAKNRRDRNSWGGFSEKTYEWSSEEEEPVKKAGPVQVLIVKDDHSFELDETALNRILLSEAVRDKEVVAVSVAGAFRKGKSFLMDFMLRYMYNQESVDWV
Host
Mouse
Reactivity
Human, Rat
Interspecies Antigen Sequence
Mouse (96); Rat (96)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
SPG3A monoclonal antibody (M03), clone 1B9 Western Blot analysis of SPG3A expression in IMR-32 ( Cat # L008V1 ).Western Blot (Cell lysate)
SPG3A monoclonal antibody (M03), clone 1B9. Western Blot analysis of SPG3A expression in PC-12 ( Cat # L012V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SPG3A is approximately 1ng/ml as a capture antibody.ELISA
-
Gene Info — ATL1
Entrez GeneID
51062GeneBank Accession#
NM_015915Protein Accession#
NP_056999Gene Name
ATL1
Gene Alias
AD-FSP, FSP1, GBP3, SPG3, SPG3A, atlastin1
Gene Description
atlastin GTPase 1
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a GTPase and a Golgi body transmembrane protein. The encoded protein can form a homotetramer and has been shown to interact with spastin and with mitogen-activated protein kinase kinase kinase kinase 4. This protein may be involved in axonal maintenance as evidenced by the fact that defects in this gene are a cause of spastic paraplegia type 3. Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq
Other Designations
GTP-binding protein 3|atlastin-1|brain-specific GTP-binding protein|guanine nucleotide-binding protein 3|guanylate-binding protein 3
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com