UBQLN2 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
UBQLN2 polyclonal antibody (A01), Lot # 061101JCS1 Western Blot analysis of UBQLN2 expression in Jurkat ( Cat # L017V1 ).
Western Blot detection against Immunogen (33.81 KDa) .
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant UBQLN2.
Immunogen
UBQLN2 (NP_038472, 555 a.a. ~ 624 a.a) partial recombinant protein with GST tag.
Sequence
PNQQFIQQMVQALAGANAPQLPNPEVRFQQQLEQLNAMGFLNREANLQALIATGGDINAAIERLLGSQPS
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (87); Rat (86)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (33.81 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
UBQLN2 polyclonal antibody (A01), Lot # 061101JCS1 Western Blot analysis of UBQLN2 expression in Jurkat ( Cat # L017V1 ).Western Blot (Recombinant protein)
ELISA
-
Gene Info — UBQLN2
Entrez GeneID
29978GeneBank Accession#
NM_013444Protein Accession#
NP_038472Gene Name
UBQLN2
Gene Alias
CHAP1, CHAP1/DSK2, Dsk2, HRIHFB2157, LIC-2, N4BP4, PLIC-2, PLIC2, RIHFB2157
Gene Description
ubiquilin 2
Omim ID
300264Gene Ontology
HyperlinkGene Summary
This gene encodes an ubiquitin-like protein (ubiquilin) that shares high degree of similarity with related products in yeast, rat and frog. Ubiquilins contain a N-terminal ubiquitin-like domain and a C-terminal ubiquitin-associated domain. They physically associate with both proteasomes and ubiquitin ligases, and thus thought to functionally link the ubiquitination machinery to the proteasome to affect in vivo protein degradation. This ubiquilin has also been shown to bind the ATPase domain of the Hsp70-like Stch protein. [provided by RefSeq
Other Designations
Nedd4 binding protein 4|bA431N15.1 (ubiquilin 2)
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com