PYCARD (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human PYCARD full-length ORF ( AAH13569.2, 1 a.a. - 149 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MDALDLTDKLVSFYLETYGAELTANVLRDMGLQEMAGQLQAATHQGSGAAPAGIQAPPQSAAKPGLHFIDQHRAALIARVTNVEWLLDALYGKVLTDEQYQAVRAEPTNPSKMRKLFNFTPAWNWTCKDLLLQALRESQSYLVEDLERS
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
42.13
Interspecies Antigen Sequence
Mouse (71); Rat (69)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — PYCARD
Entrez GeneID
29108GeneBank Accession#
BC013569Protein Accession#
AAH13569.2Gene Name
PYCARD
Gene Alias
ASC, CARD5, MGC10332, TMS, TMS-1, TMS1
Gene Description
PYD and CARD domain containing
Omim ID
606838Gene Ontology
HyperlinkGene Summary
This gene encodes an adaptor protein that is composed of two protein-protein interaction domains: a N-terminal PYRIN-PAAD-DAPIN domain (PYD) and a C-terminal caspase-recruitment domain (CARD). The PYD and CARD domains are members of the six-helix bundle death domain-fold superfamily that mediates assembly of large signaling complexes in the inflammatory and apoptotic signaling pathways via the activation of caspase. In normal cells, this protein is localized to the cytoplasm; however, in cells undergoing apoptosis, it forms ball-like aggregates near the nuclear periphery. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
apoptosis-associated speck-like protein containing a CARD|caspase recruitment domain protein 5|target of methylation-induced silencing-1
-
Interactome
-
Disease
-
Publication Reference
-
Targeting ASC in NLRP3 inflammasome by caffeic acid phenethyl ester: a novel strategy to treat acute gout.
Lee HE, Yang G, Kim ND, Jeong S, Jung Y, Choi JY, Park HH, Lee JY.
Scientific Reports 2016 Dec; 6:38622.
Application：Func, PI, Recombinant protein.
-
Molecular Basis of Acute Cystitis Reveals Susceptibility Genes and Immunotherapeutic Targets.
Ambite I, Puthia M, Nagy K, Cafaro C, Nadeem A, Butler DS, Rydström G, Filenko NA, Wullt B, Miethke T, Svanborg C.
PLoS Pathogens 2016 Oct; 12(10):e1005848.
Application：Func, EMSA, Human, Recombinant protein.
-
NLRP3 activation and mitosis are mutually exclusive events coordinated by NEK7, a new inflammasome component.
Shi H, Wang Y, Li X, Zhan X, Tang M, Fina M, Su L, Pratt D, Bu CH, Hildebrand S, Lyon S, Scott L, Quan J, Sun Q, Russell J, Arnett S, Jurek P, Chen D, Kravchenko VV, Mathison JC, Moresco EM, Monson NL, Ulevitch RJ, Beutler B.
Nature Immunology 2016 Mar; 17(3):250.
Application：WB-Ce, Human, J774A.1 cells, Macrophages.
-
Targeting ASC in NLRP3 inflammasome by caffeic acid phenethyl ester: a novel strategy to treat acute gout.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com