PPP2R3B (Human) Recombinant Protein (P02)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human PPP2R3B full-length ORF ( AAH09032, 1 a.a. - 176 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MDLDGDGALSMFELEYFYEEQCRRLDSMAIEALPFQDCLCQMLDLVKPRTEGKITLQDLKRCKLANVFFDTFFNIEKYLDHEQKEQISLLRDGDSGGPELSDWEKYAAEEYDILVAEETAGEPWEDGFEAELSPVEQKLSALRSPLAQRPFFEAPSPLGAVDLYEYACGDEDLESL
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
45.1
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — PPP2R3B
Entrez GeneID
28227GeneBank Accession#
BC009032Protein Accession#
AAH09032Gene Name
PPP2R3B
Gene Alias
NY-REN-8, PPP2R3L, PPP2R3LY, PR48
Gene Description
protein phosphatase 2 (formerly 2A), regulatory subunit B'', beta
Omim ID
300339Gene Ontology
HyperlinkGene Summary
Protein phosphatase 2 (formerly named type 2A) is one of the four major Ser/Thr phosphatases and is implicated in the negative control of cell growth and division. Protein phosphatase 2 holoenzymes are heterotrimeric proteins composed of a structural subunit A, a catalytic subunit C, and a regulatory subunit B. The regulatory subunit is encoded by a diverse set of genes that have been grouped into the B/PR55, B'/PR61, and B''/PR72 families. These different regulatory subunits confer distinct enzymatic specificities and intracellular localizations to the holozenzyme. The product of this gene belongs to the B'' family. The B'' family has been further divided into subfamilies. The product of this gene belongs to the beta subfamily of regulatory subunit B''. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq
Other Designations
NY-REN-8 antigen|OTTHUMP00000022820|PP2A B'' subunit PR48|PP2A, subunit B, PR48 isoform|protein phosphatase 2, regulatory subunit B'', beta|serine/threonine protein phosphatase 2A, 48kDa regulatory subunit B
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com