DHDH monoclonal antibody (M03), clone 3A11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of DHDH expression in transfected 293T cell line by DHDH monoclonal antibody (M03), clone 3A11.
Lane 1: DHDH transfected lysate (Predicted MW: 36.4 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged DHDH is 0.1 ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant DHDH.
Immunogen
DHDH (NP_055290, 235 a.a. ~ 334 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SNTASVSGTKGMAQLLNPCWCPTELVVKGEHKEFPLPPVPKDCNFDNGAGMSYEAKHVWECLRKGMKESPVIPLSESELLADILEEVRKAIGVTFPQDKR
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (78); Rat (77)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of DHDH expression in transfected 293T cell line by DHDH monoclonal antibody (M03), clone 3A11.
Lane 1: DHDH transfected lysate (Predicted MW: 36.4 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged DHDH is 0.1 ng/ml as a capture antibody.ELISA
-
Gene Info — DHDH
Entrez GeneID
27294GeneBank Accession#
NM_014475Protein Accession#
NP_055290Gene Name
DHDH
Gene Alias
HUM2DD
Gene Description
dihydrodiol dehydrogenase (dimeric)
Omim ID
606377Gene Ontology
HyperlinkGene Summary
This gene encodes an enzyme that belongs to the family of dihydrodiol dehydrogenases, which exist in multiple forms in mammalian tissues and are involved in the metabolism of xenobiotics and sugars. These enzymes catalyze the NADP1-linked oxidation of transdihydrodiols of aromatic hydrocarbons to corresponding catechols. This enzyme is a dimeric dihydrodiol dehydrogenase, and it differs from monomeric dihydrodiol dehydrogenases in its high substrate specificity for trans-dihydrodiols of aromatic hydrocarbons in the oxidative direction. [provided by RefSeq
Other Designations
3-deoxyglucosone reductase|dimeric dihydrodiol dehydrogenase
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com