STAU2 monoclonal antibody (M01), clone 5C5

Catalog # H00027067-M01

Size

Price

Stock

Quantity

Size:100 ug
Price: USD $ 335.00
Stock:
order now, ship next day
abnova-minus
abnova-plus

* The price is valid only in USA. Please select country.

Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
Images
Western Blot (Cell lysate)
Application

Western Blot (Cell lysate)

STAU2 monoclonal antibody (M01), clone 5C5. Western Blot analysis of STAU2 expression in HL-60.

Western Blot (Cell lysate)
Application

Western Blot (Cell lysate)

STAU2 monoclonal antibody (M01), clone 5C5 Western Blot analysis of STAU2 expression in IMR-32 ( Cat # L008V1 ).

Western Blot (Cell lysate)
Application

Western Blot (Cell lysate)

STAU2 monoclonal antibody (M01), clone 5C5. Western Blot analysis of STAU2 expression in NIH/3T3.

Western Blot (Cell lysate)
Application

Western Blot (Cell lysate)

STAU2 monoclonal antibody (M01), clone 5C5. Western Blot analysis of STAU2 expression in K-562.

Western Blot (Cell lysate)
Application

Western Blot (Cell lysate)

STAU2 monoclonal antibody (M01), clone 5C5. Western Blot analysis of STAU2 expression in COLO 320 HSR ( Cat # L020V1 ).

Western Blot (Transfected lysate)
Application

Western Blot (Transfected lysate)

Western Blot analysis of STAU2 expression in transfected 293T cell line by STAU2 monoclonal antibody (M01), clone 5C5.

Lane 1: STAU2 transfected lysate(52.8 KDa).
Lane 2: Non-transfected lysate.

Sandwich ELISA (Recombinant protein)
Application

Sandwich ELISA (Recombinant protein)

Detection limit for recombinant GST tagged STAU2 is approximately 0.03ng/ml as a capture antibody.

QC Test

Western Blot detection against Immunogen (35.53 KDa) .

  • Specification

    Product Description

    Mouse monoclonal antibody raised against a partial recombinant STAU2.

    Immunogen

    STAU2 (NP_055208, 2 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

    Sequence

    LQINQMFSVQLSLGEQTWESEGSSIKKAQQAVANKALTESTLPKPVQKPPKSNVNNNPGSITPTVELNGLAMKRGEPAIYRPLDPKPFP

    Host

    Mouse

    Reactivity

    Human, Mouse

    Interspecies Antigen Sequence

    Mouse (95); Rat (94)

    Isotype

    IgG1 Kappa

    Quality Control Testing

    Antibody Reactive Against Recombinant Protein.

    Western Blot detection against Immunogen (35.53 KDa) .

    Storage Buffer

    In 1x PBS, pH 7.4

    Storage Instruction

    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

  • Applications

    Western Blot (Cell lysate)

    STAU2 monoclonal antibody (M01), clone 5C5. Western Blot analysis of STAU2 expression in HL-60.

    Western Blot (Cell lysate)

    STAU2 monoclonal antibody (M01), clone 5C5 Western Blot analysis of STAU2 expression in IMR-32 ( Cat # L008V1 ).

    Western Blot (Cell lysate)

    STAU2 monoclonal antibody (M01), clone 5C5. Western Blot analysis of STAU2 expression in NIH/3T3.

    Western Blot (Cell lysate)

    STAU2 monoclonal antibody (M01), clone 5C5. Western Blot analysis of STAU2 expression in K-562.

    Western Blot (Cell lysate)

    STAU2 monoclonal antibody (M01), clone 5C5. Western Blot analysis of STAU2 expression in COLO 320 HSR ( Cat # L020V1 ).

    Western Blot (Transfected lysate)

    Western Blot analysis of STAU2 expression in transfected 293T cell line by STAU2 monoclonal antibody (M01), clone 5C5.

    Lane 1: STAU2 transfected lysate(52.8 KDa).
    Lane 2: Non-transfected lysate.

    Western Blot (Recombinant protein)

    Sandwich ELISA (Recombinant protein)

    Detection limit for recombinant GST tagged STAU2 is approximately 0.03ng/ml as a capture antibody.

    ELISA

  • Gene Info — STAU2

    Entrez GeneID

    27067

    GeneBank Accession#

    NM_014393

    Protein Accession#

    NP_055208

    Gene Name

    STAU2

    Gene Alias

    39K2, 39K3, DKFZp781K0371, MGC119606

    Gene Description

    staufen, RNA binding protein, homolog 2 (Drosophila)

    Omim ID

    605920

    Gene Ontology

    Hyperlink

    Gene Summary

    Staufen homolog 2 is a member of the family of double-stranded RNA (dsRNA)-binding proteins involved in the transport and/or localization of mRNAs to different subcellular compartments and/or organelles. These proteins are characterized by the presence of multiple dsRNA-binding domains which are required to bind RNAs having double-stranded secondary structures. Staufen homolog 2 shares 48.5% and 59.9% similarity with drosophila and human staufen, respectively. The exact function of Staufen homolog 2 is not known, but since it contains 3 copies of conserved dsRNA binding domain, it could be involved in double-stranded RNA binding events. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

    Other Designations

    staufen homolog 2

  • Interactome
Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
4 Products to Compare
Remove All