GPSM1 (Human) Recombinant Protein (P02)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human GPSM1 full-length ORF ( AAH48343.1, 1 a.a. - 166 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MDDQRCPLDDGQAGAAEATAAPTLEDRIAQPSMTASPQTEEFFDLIASSQSRRLDDQRASVGSLPGLRITHSNAGHLRGHGEPQEPGDDFFNMLIKYQSSRIDDQRCPPPDVLPRGPTMPDEDFFSLIQRVQAKRMDEQRVDLAGGPEQGAGGPPEPQQQCQPGAS
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
44.4
Interspecies Antigen Sequence
Mouse (94); Rat (94)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — GPSM1
Entrez GeneID
26086GeneBank Accession#
BC048343.1Protein Accession#
AAH48343.1Gene Name
GPSM1
Gene Alias
AGS3, DKFZp727I051
Gene Description
G-protein signaling modulator 1 (AGS3-like, C. elegans)
Omim ID
609491Gene Ontology
HyperlinkGene Summary
G proteins propagate intracellular signals initiated by G protein-coupled receptors. GPSM1, a receptor-independent activator of G protein signaling, is one of several factors that influence the basal activity of G protein signaling systems (Pizzinat et al., 2001 [PubMed 11278352]).[supplied by OMIM
Other Designations
1810037C22Rik|G-protein signalling modulator 1 (AGS3-like, C. elegans)|OTTHUMP00000022584|OTTHUMP00000046384|OTTHUMP00000046385|activator of G-protein signaling 3
-
Interactome
-
Publication Reference
-
GPSM1 impairs metabolic homeostasis by controlling a pro-inflammatory pathway in macrophages.
Jing Yan, Yuemei Zhang, Hairong Yu, Yicen Zong, Daixi Wang, Jiangfei Zheng, Li Jin, Xiangtian Yu, Caizhi Liu, Yi Zhang, Feng Jiang, Rong Zhang, Xiangnan Fang, Ting Xu, Mingyu Li, Jianzhong Di, Yan Lu, Xinran Ma, Jian Zhang, Weiping Jia, Cheng Hu.
Nature Communications 2022 Nov; 13(1):7260.
Application:SPR, Recombinant proteins.
-
GPSM1 impairs metabolic homeostasis by controlling a pro-inflammatory pathway in macrophages.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com