GPSM1 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
GPSM1 MaxPab polyclonal antibody. Western Blot analysis of GPSM1 expression in rat brain.
Western Blot (Transfected lysate)
Western Blot analysis of GPSM1 expression in transfected 293T cell line (H00026086-T01) by GPSM1 MaxPab polyclonal antibody.
Lane 1: GPSM1 transfected lysate(18.26 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human GPSM1 protein.
Immunogen
GPSM1 (AAH48343.1, 1 a.a. ~ 166 a.a) full-length human protein.
Sequence
MDDQRCPLDDGQAGAAEATAAPTLEDRIAQPSMTASPQTEEFFDLIASSQSRRLDDQRASVGSLPGLRITHSNAGHLRGHGEPQEPGDDFFNMLIKYQSSRIDDQRCPPPDVLPRGPTMPDEDFFSLIQRVQAKRMDEQRVDLAGGPEQGAGGPPEPQQQCQPGAS
Host
Mouse
Reactivity
Human, Rat
Interspecies Antigen Sequence
Mouse (94); Rat (94)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
GPSM1 MaxPab polyclonal antibody. Western Blot analysis of GPSM1 expression in rat brain.Western Blot (Transfected lysate)
Western Blot analysis of GPSM1 expression in transfected 293T cell line (H00026086-T01) by GPSM1 MaxPab polyclonal antibody.
Lane 1: GPSM1 transfected lysate(18.26 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — GPSM1
Entrez GeneID
26086GeneBank Accession#
BC048343.1Protein Accession#
AAH48343.1Gene Name
GPSM1
Gene Alias
AGS3, DKFZp727I051
Gene Description
G-protein signaling modulator 1 (AGS3-like, C. elegans)
Omim ID
609491Gene Ontology
HyperlinkGene Summary
G proteins propagate intracellular signals initiated by G protein-coupled receptors. GPSM1, a receptor-independent activator of G protein signaling, is one of several factors that influence the basal activity of G protein signaling systems (Pizzinat et al., 2001 [PubMed 11278352]).[supplied by OMIM
Other Designations
1810037C22Rik|G-protein signalling modulator 1 (AGS3-like, C. elegans)|OTTHUMP00000022584|OTTHUMP00000046384|OTTHUMP00000046385|activator of G-protein signaling 3
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com