CORO1C monoclonal antibody (M02), clone 1F7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CORO1C.
Immunogen
CORO1C (NP_055140, 375 a.a. ~ 473 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
EEWFEGKNADPILISLKHGYIPGKNRDLKVVKKNILDSKPTANKKCDLISIPKKTTDTASVQNEAKLDEILKEIKSIKDTICNQDERISKLEQQMAKIA
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (97); Rat (98)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
CORO1C monoclonal antibody (M02), clone 1F7. Western Blot analysis of CORO1C expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to CORO1C on formalin-fixed paraffin-embedded human uterine cervix. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CORO1C is 0.1 ng/ml as a capture antibody.ELISA
-
Gene Info — CORO1C
Entrez GeneID
23603GeneBank Accession#
NM_014325Protein Accession#
NP_055140Gene Name
CORO1C
Gene Alias
HCRNN4
Gene Description
coronin, actin binding protein, 1C
Omim ID
605269Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. [provided by RefSeq
Other Designations
coronin 1C|coronin, actin-binding protein, 1C|coronin-3
-
Interactome
-
Disease
-
Publication Reference
-
Cytoplasmic RAD23B interacts with CORO1C to synergistically promote colorectal cancer progression and metastasis.
Jun Li, Lusong Tian, Zongpan Jing, Zhengguang Guo, Peng Nan, Fang Liu, Shuangmei Zou, Lijun Yang, Xiufeng Xie, Ying Zhu, Yue Zhao, Wei Sun, Yulin Sun, Xiaohang Zhao.
Cancer Letters 2021 May; 516:13.
Application:IF, IHC, Human, HCT-8, SW480 cells, Human colorectal cancer.
-
YBX1 gene silencing inhibits migratory and invasive potential via CORO1C in breast cancer in vitro.
Lim JP, Shyamasundar S, Gunaratne J, Scully OJ, Matsumoto K, Bay BH.
BMC Cancer 2017 Mar; 17(1):201.
Application:WB-Tr, Human, Hs578T, MDA-MB-231 cells.
-
Dual role of ALCAM in neuroinflammation and blood-brain barrier homeostasis.
Lécuyer MA, Saint-Laurent O, Bourbonnière L, Larouche S, Larochelle C, Michel L, Charabati M, Abadier M, Zandee S, Haghayegh Jahromi N, Gowing E, Pittet C, Lyck R, Engelhardt B, Prat A.
PNAS 2017 Jan; 114(4):E524.
Application:WB-Ce, Mouse, Mouse brain parenchymal capillary cells.
-
Activated Cdc42-Bound IQGAP1 Determines the Cellular Endocytic Site.
Kimura T, Yamaoka M, Taniguchi S, Okamoto M, Takei M, Ando T, Iwamatsu A, Watanabe T, Kaibuchi K, Ishizaki T, Niki I.
Molecular and Cellular Biology 2013 Dec; 33(24):4834.
Application:WB-Ce, WB-Tr, Monkey, Mouse, MIN6, COS-7 cells.
-
Cytoplasmic RAD23B interacts with CORO1C to synergistically promote colorectal cancer progression and metastasis.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com