CLEC5A purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human CLEC5A protein.
Immunogen
CLEC5A (NP_037384.1, 1 a.a. ~ 188 a.a) full-length human protein.
Sequence
MNWHMIISGLIVVVLKVVGMTLFLLYFPQIFNKSNDGFTTTRSYGTVSQIFGSSSPSPNGFITTRSYGTVCPKDWEFYQARCFFLSTSESSWNESRDFCKGKGSTLAIVNTPEKLKFLQDITDAEKYFIGLIYHREEKRWRWINNSVFNGNVTNQNQNFNCATIGLTKTFDAASCDISYRRICEKNAK
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (70); Rat (70)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
CLEC5A MaxPab polyclonal antibody. Western Blot analysis of CLEC5A expression in human liver.Western Blot (Transfected lysate)
Western Blot analysis of CLEC5A expression in transfected 293T cell line (H00023601-T01) by CLEC5A MaxPab polyclonal antibody.
Lane 1: CLEC5A transfected lysate(20.68 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — CLEC5A
Entrez GeneID
23601GeneBank Accession#
NM_013252.2Protein Accession#
NP_037384.1Gene Name
CLEC5A
Gene Alias
CLECSF5, MDL-1, MDL1, MGC138304
Gene Description
C-type lectin domain family 5, member A
Omim ID
604987Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. The encoded type II transmembrane protein interacts with dnax-activation protein 12 and may play a role in cell activation. Alternative splice variants have been described but their full-length sequence has not been determined. [provided by RefSeq
Other Designations
C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 5|C-type lectin, superfamily member 5|myeloid DAP12-associating lectin-1
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com