ACATE2 monoclonal antibody (M01), clone 4E4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
ACATE2 monoclonal antibody (M01), clone 4E4 Western Blot analysis of ACATE2 expression in MCF-7 ( Cat # L046V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of ACOT9 expression in transfected 293T cell line by ACATE2 monoclonal antibody (M01), clone 4E4.
Lane 1: ACOT9 transfected lysate(24 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to ACOT9 on formalin-fixed paraffin-embedded human heart. [antibody concentration 3 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ACOT9 is approximately 3ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to ACOT9 on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (49.06 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant ACATE2.
Immunogen
ACATE2 (AAH12573, 1 a.a. ~ 212 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MRRAALRLCALGKGQLTPGRGLTQGPQNPKKQGIFHIHEVRDKLREIVGASTNWRDHVKAMEERKLLHSFLAKSQDGLPPRRMKDSYIEVLLPLGSEPELREKYLTVQNTVRFGRILEDLDSLGVLICYMHNKIHSAKMSPLSIVTALVDKIDMCKKSLSPEQDIKFSGHVSWVGKTSMEVKMQMFQLHGDEFCPVLDATFVMVARDSENKG
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (80); Rat (79)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (49.06 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
ACATE2 monoclonal antibody (M01), clone 4E4 Western Blot analysis of ACATE2 expression in MCF-7 ( Cat # L046V1 ).Western Blot (Transfected lysate)
Western Blot analysis of ACOT9 expression in transfected 293T cell line by ACATE2 monoclonal antibody (M01), clone 4E4.
Lane 1: ACOT9 transfected lysate(24 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to ACOT9 on formalin-fixed paraffin-embedded human heart. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ACOT9 is approximately 3ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to ACOT9 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — ACOT9
Entrez GeneID
23597GeneBank Accession#
BC012573Protein Accession#
AAH12573Gene Name
ACOT9
Gene Alias
ACATE2, CGI-16, MT-ACT48
Gene Description
acyl-CoA thioesterase 9
Gene Ontology
HyperlinkGene Summary
mitochondrial|mitochondrial Acyl-CoA Thioesterase
Other Designations
OTTHUMP00000023065|acyl-Coenzyme A thioesterase 2, mitochondrial|mitochondrial Acyl-CoA Thioesterase
-
Interactome
-
Publication Reference
-
Proteomic Analysis of Left Ventricular Remodeling in an Experimental Model of Heart Failure.
Cieniewski-Bernard C, Mulder P, Henry JP, Drobecq H, Dubois E, Pottiez G, Thuillez C, Amouyel P, Richard V, Pinet F.
Journal of Proteome Research 2008 Oct; 7(11):5004.
Application：WB, Rat, Rat heart.
-
Proteomic Analysis of Left Ventricular Remodeling in an Experimental Model of Heart Failure.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com