PDSS1 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human PDSS1 full-length ORF ( AAH63635.1, 1 a.a. - 306 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MASRWWRWRRGCSWKPAARSPGPGSPGRAVPLGPSAAAEVRAQVHRRKGLDLSQIPYINLVKHLTSACPNVCRISRFHHTTPDSKTHSGEKYTDPFKLGWRDLKGLYEDIRKELLISTSELKEMSEYYFDGKGKAFRPIIVALMARACNIHHNNSRHVQASQRAIALIAEMIHTASLVHDDVIDDASSRRGKHTVNKIWGEKKAVLAGDLILSAASIALARIGNTTVISILTQVIEDLVRGEFLQLGSKENENERFAHYLEKTFKKTASLIANSCKAVFPRNECYDHATVQFAWRCRQSSTVCTTE
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
60.7
Interspecies Antigen Sequence
Mouse (76); Rat (77)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — PDSS1
Entrez GeneID
23590GeneBank Accession#
BC063635.1Protein Accession#
AAH63635.1Gene Name
PDSS1
Gene Alias
COQ1, DPS, MGC70953, RP13-16H11.3, SPS, TPRT, TPT, hDPS1
Gene Description
prenyl (decaprenyl) diphosphate synthase, subunit 1
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is an enzyme that elongates the prenyl side-chain of coenzyme Q, or ubiquinone, one of the key elements in the respiratory chain. The gene product catalyzes the formation of all trans-polyprenyl pyrophosphates from isopentyl diphosphate in the assembly of polyisoprenoid side chains, the first step in coenzyme Q biosynthesis. The protein may be peripherally associated with the inner mitochondrial membrane, though no transit peptide has been definitively identified to date. Defects in this gene are a cause of coenzyme Q10 deficiency. [provided by RefSeq
Other Designations
OTTHUMP00000019346|coenzyme Q1 homolog|polyprenyl pyrophosphate synthetase|prenyl diphosphate synthase, subunit 1|subunit 1 of decaprenyl diphosphate synthase|trans-prenyltransferase (TPT)
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com