CDC42EP4 monoclonal antibody (M05), clone 3G10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of CDC42EP4 expression in transfected 293T cell line by CDC42EP4 monoclonal antibody (M05), clone 3G10.
Lane 1: CDC42EP4 transfected lysate (Predicted MW: 38 KDa).
Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (32.67 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CDC42EP4.
Immunogen
CDC42EP4 (NP_036253, 163 a.a. ~ 225 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
VPRRNGAAGPHSPDPLLDEQAFGDLTDLPVVPKATYGLKHAESIMSFHIDLGPSMLGDVLSIM
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (78); Rat (77)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (32.67 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of CDC42EP4 expression in transfected 293T cell line by CDC42EP4 monoclonal antibody (M05), clone 3G10.
Lane 1: CDC42EP4 transfected lysate (Predicted MW: 38 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
ELISA
-
Gene Info — CDC42EP4
Entrez GeneID
23580GeneBank Accession#
NM_012121Protein Accession#
NP_036253Gene Name
CDC42EP4
Gene Alias
BORG4, CEP4, KAIA1777, MGC17125, MGC3740
Gene Description
CDC42 effector protein (Rho GTPase binding) 4
Omim ID
605468Gene Ontology
HyperlinkGene Summary
The product of this gene is a member of the CDC42-binding protein family. Members of this family interact with Rho family GTPases and regulate the organization of the actin cytoskeleton. This protein has been shown to bind both CDC42 and TC10 GTPases in a GTP-dependent manner. When overexpressed in fibroblasts, this protein was able to induce pseudopodia formation, which suggested a role in inducing actin filament assembly and cell shape control. [provided by RefSeq
Other Designations
Cdc42 effector protein 4|binder of Rho GTPases 4
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com