ATP6V0A2 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant ATP6V0A2.
Immunogen
ATP6V0A2 (NP_036595, 198 a.a. ~ 304 a.a) partial recombinant protein with GST tag.
Sequence
GYTIVSYAELDESLEDPETGEVIKWYVFLISFWGEQIGHKVKKICDCYHCHVYPYPNTAEERREIQEGLNTRIQDLYTVLHKTEDYLRQVLCKAAESVYSRVIQVKK
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.88 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
ATP6V0A2 polyclonal antibody (A01), Lot # 051214JC01 Western Blot analysis of ATP6V0A2 expression in HL-60 ( Cat # L014V1 ).Western Blot (Recombinant protein)
ELISA
-
Gene Info — ATP6V0A2
Entrez GeneID
23545GeneBank Accession#
NM_012463Protein Accession#
NP_036595Gene Name
ATP6V0A2
Gene Alias
ARCL, ATP6N1D, ATP6a2, J6B7, Stv1, TJ6, TJ6M, TJ6s, Vph1, WSS, a2
Gene Description
ATPase, H+ transporting, lysosomal V0 subunit a2
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a subunit of the vacuolar ATPase (v-ATPase), an heteromultimeric enzyme that is present in intracellular vesicles and in the plasma membrane of specialized cells, and which is essential for the acidification of diverse cellular components. V-ATPase is comprised of a membrane peripheral V(1) domain for ATP hydrolysis, and an integral membrane V(0) domain for proton translocation. The subunit encoded by this gene is a component of the V(0) domain. Mutations in this gene are a cause of both cutis laxa type II and wrinkly skin syndrome. [provided by RefSeq
Other Designations
ATPase, H+ transporting, lysosomal V0 subunit A2|infantile malignant osteopetrosis
-
Interactome
-
Pathway
-
Publication Reference
-
(Pro)renin receptor is required for prorenin-dependent and -independent regulation of vacuolar H+-ATPase activity in MDCK.C11 collecting duct cells.
Lu X, Garrelds IM, Wagner CA, Danser AH, Meima ME.
American Journal of Physiology. Renal Physiology 2013 Aug; 305(3):F417.
Application:WB-Tr, Dog, MCDK.C11 cells.
-
(Pro)renin receptor is required for prorenin-dependent and -independent regulation of vacuolar H+-ATPase activity in MDCK.C11 collecting duct cells.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com