DICER1 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human DICER1 partial ORF ( NP_803187, 1813 a.a. - 1912 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
ESLAGAIYMDSGMSLETVWQVYYPMMRPLIEKFSANVPRSPVRELLEMEPETAKFSPAERTYDGKVRVTVEVVGKGKFKGVGRSYRIAKSAAARRALRSL
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.74
Interspecies Antigen Sequence
Mouse (98)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — DICER1
Entrez GeneID
23405GeneBank Accession#
NM_177438Protein Accession#
NP_803187Gene Name
DICER1
Gene Alias
DCR1, Dicer, HERNA, KIAA0928
Gene Description
dicer 1, ribonuclease type III
Omim ID
606241Gene Ontology
HyperlinkGene Summary
This gene encodes a protein possessing an RNA helicase motif containing a DEXH box in its amino terminus and an RNA motif in the carboxy terminus. The encoded protein functions as a ribonuclease and is required by the RNA interference and small temporal RNA (stRNA) pathways to produce the active small RNA component that represses gene expression. Two transcript variants encoding the same protein have been identified for this gene. [provided by RefSeq
Other Designations
Dicer1, Dcr-1 homolog|K12H4.8-LIKE|dicer 1, double-stranded RNA-specific endoribonuclease|dicer1|helicase with RNAse motif|helicase-moi
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com