DIP2A monoclonal antibody (M01), clone 4E6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of DIP2A expression in transfected 293T cell line by DIP2A monoclonal antibody (M01), clone 4E6.
Lane 1: DIP2A transfected lysate (Predicted MW: 170.3 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged DIP2A is 0.3 ng/ml as a capture antibody.
Western Blot detection against Immunogen (47.275 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant DIP2A.
Immunogen
DIP2A (NP_055966, 107 a.a. ~ 301 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
KYKERKMPMPSKRRSVLVHSSVETYTPPDTSSASEDEGSLRRPGRLTSTPLQSHSSVEPWLDRVIQGSSTSSSASSTSSHPGGRPTTAPSAAATPGAAATTALAGLEAHTHIDLHSAPPDVTTGLVEHSYFERPQVASVRSVPRGCSGSMLETADGVPVNSRVSSKIQQLLNTLKRPKRPPLKEFFVDDFEELLE
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (89); Rat (88)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (47.275 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of DIP2A expression in transfected 293T cell line by DIP2A monoclonal antibody (M01), clone 4E6.
Lane 1: DIP2A transfected lysate (Predicted MW: 170.3 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged DIP2A is 0.3 ng/ml as a capture antibody.ELISA
-
Gene Info — DIP2A
Entrez GeneID
23181GeneBank Accession#
NM_015151Protein Accession#
NP_055966Gene Name
DIP2A
Gene Alias
C21orf106, DIP2
Gene Description
DIP2 disco-interacting protein 2 homolog A (Drosophila)
Omim ID
607711Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene may be involved in axon patterning in the central nervous system. This gene is not highly expressed. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
DIP2-like protein|disco-interacting protein 2 homolog
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com