LPIN1 monoclonal antibody (M03), clone 3D9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of LPIN1 expression in transfected 293T cell line by LPIN1 monoclonal antibody (M03), clone 3D9.
Lane 1: LPIN1 transfected lysate (Predicted MW: 98.7 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged LPIN1 is 1 ng/ml as a capture antibody.
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant LPIN1.
Immunogen
LPIN1 (NP_663731.1, 792 a.a. ~ 890 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
EPFYAAFGNRPADVYSYKQVGVSLNRIFTVNPKGELVQEHAKTNISSYVRLCEVVDHVFPLLKRSHSSDFPCSDTFSNFTFWREPLPPFENQDIHSASA
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (85); Rat (85)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of LPIN1 expression in transfected 293T cell line by LPIN1 monoclonal antibody (M03), clone 3D9.
Lane 1: LPIN1 transfected lysate (Predicted MW: 98.7 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged LPIN1 is 1 ng/ml as a capture antibody.ELISA
-
Gene Info — LPIN1
Entrez GeneID
23175GeneBank Accession#
NM_145693Protein Accession#
NP_663731.1Gene Name
LPIN1
Gene Alias
DKFZp781P1796, KIAA0188, PAP1
Gene Description
lipin 1
Omim ID
605518Gene Ontology
HyperlinkGene Summary
This gene represents a candidate gene for human lipodystrophy, characterized by loss of body fat, fatty liver, hypertriglyceridemia, and insulin resistance. Mouse studies suggest that this gene functions during normal adipose tissue development and may also play a role in human triglyceride metabolism. [provided by RefSeq
Other Designations
-
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com