MRPS27 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human MRPS27 protein.
Immunogen
MRPS27 (AAH30521.1, 1 a.a. ~ 168 a.a) full-length human protein.
Sequence
MPLIWKPGYLDRALQVMEKVAASPEDIKLCREALDVLGAVLKALTSADGASEEQSQNDEDNQGSEKLVEQLDIEETEQSKLPQYLERFKALHSKLQALGKIESEGLLSLTTQLVKEKLSTCEAEDIATYEQNLQQWHLDLVQLIQREQQQREQAKQEYQAQKAAKASA
Host
Rabbit
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
MRPS27 MaxPab rabbit polyclonal antibody. Western Blot analysis of MRPS27 expression in Jurkat.Western Blot (Transfected lysate)
Western Blot analysis of MRPS27 expression in transfected 293T cell line (H00023107-T02) by MRPS27 MaxPab polyclonal antibody.
Lane 1: MRPS27 transfected lysate(19.00 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — MRPS27
Entrez GeneID
23107GeneBank Accession#
BC030521Protein Accession#
AAH30521.1Gene Name
MRPS27
Gene Alias
FLJ21764, FLJ23348, KIAA0264, MRP-S27, S27mt
Gene Description
mitochondrial ribosomal protein S27
Gene Ontology
HyperlinkGene Summary
Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that may be a functional partner of the death associated protein 3 (DAP3). [provided by RefSeq
Other Designations
mitochondrial 28S ribosomal protein S27
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com