TXNDC4 monoclonal antibody (M01), clone 3C7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant TXNDC4.
Immunogen
TXNDC4 (AAH05374, 30 a.a. ~ 406 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
EITSLDTENIDEILNNADVALVNFYADWCRFSQMLHPIFEEASDVIKEEFPNENQVVFARVDCDQHSDIAQRYRISKYPTLKLFRNGMMMKREYRGQRSVKALADYIRQQKSDPIQEIRDLAEITTLDRSKRNIIGYFEQKDSDNYRVFERVANILHDDCAFLSAFGDVSKPERYSGDNIIYKPPGHSAPDMVYLGAMTNFDVTYNWIQDKCVPLVREITFENGEELTEEGLPFLILFHMKEDTESLEIFQNEVARQLISEKGTINFLHADCDKFRHPLLHIQKTPADCPVIAIDSFRHMYVFGDFKDVLIPGKLKQFVFDLHSGKLHREFHHGPDPTDTAPGEQAQDVASSPPESSFQKLAPSEYRYTLLRDRDEL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (93); Rat (93)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (67.21 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
TXNDC4 monoclonal antibody (M01), clone 3C7 Western Blot analysis of TXNDC4 expression in K-562 ( Cat # L009V1 ).Western Blot (Cell lysate)
TXNDC4 monoclonal antibody (M01), clone 3C7. Western Blot analysis of TXNDC4 expression in A-431 ( Cat # L015V1 ).Western Blot (Transfected lysate)
Western Blot analysis of TXNDC4 expression in transfected 293T cell line by TXNDC4 monoclonal antibody (M01), clone 3C7.
Lane 1: TXNDC4 transfected lysate(47 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to TXNDC4 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]Immunoprecipitation
Immunoprecipitation of TXNDC4 transfected lysate using anti-TXNDC4 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with TXNDC4 MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TXNDC4 is 1 ng/ml as a capture antibody.ELISA
-
Gene Info — TXNDC4
Entrez GeneID
23071GeneBank Accession#
BC005374Protein Accession#
AAH05374Gene Name
TXNDC4
Gene Alias
ERP44, KIAA0573
Gene Description
thioredoxin domain containing 4 (endoplasmic reticulum)
Omim ID
609170Gene Ontology
HyperlinkOther Designations
OTTHUMP00000021788|OTTHUMP00000063799|endoplasmic reticulum resident protein 44 kDa
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com