AKAP11 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot detection against Immunogen (37.22 KDa) .
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant AKAP11.
Immunogen
AKAP11 (NP_057332, 1801 a.a. ~ 1901 a.a) partial recombinant protein with GST tag.
Sequence
EGLGQDGKTLLITNIDMEPCTVDPQLRIILQWLIASEAEVAELYFHDSANKEFMLLSKQLQEKGWKVGDLLQAVLQYYEVMEKASSEERCKSLFDWLLENA
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (74); Rat (74)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.22 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
-
Gene Info — AKAP11
Entrez GeneID
11215GeneBank Accession#
NM_016248Protein Accession#
NP_057332Gene Name
AKAP11
Gene Alias
AKAP220, DKFZp781I12161, FLJ11304, KIAA0629, PRKA11
Gene Description
A kinase (PRKA) anchor protein 11
Omim ID
604696Gene Ontology
HyperlinkGene Summary
The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. This gene encodes a member of the AKAP family. The encoded protein is expressed at high levels throughout spermatogenesis and in mature sperm. It binds the RI and RII subunits of PKA in testis. It may serve a function in cell cycle control of both somatic cells and germ cells in addition to its putative role in spermatogenesis and sperm function. [provided by RefSeq
Other Designations
A-kinase anchor protein 11|A-kinase anchoring protein, 220kDa|protein kinase A anchoring protein 11
-
Interactome
-
Publication Reference
-
Isoform-specific targeting of PKA to multivesicular bodies.
Day ME, Gaietta GM, Sastri M, Koller A, Mackey MR, Scott JD, Perkins GA, Ellisman MH, Taylor SS.
The Journal of Cell Biology 2011 Apr; 193(2):347.
Application：WB, Human, HEK 293 cells.
-
Isoform-specific targeting of PKA to multivesicular bodies.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com