POLI monoclonal antibody (M01), clone 8G9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant POLI.
Immunogen
POLI (AAH32662, 616 a.a. ~ 715 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
PQGFHFTNSNPAVSAFHSFPNLQSEQLFSRNHTTDSHKQTVATDSHEGLTENREPDSVDEKITFPSDIDPQVFYELPEAVQKELLAEWKRAGSDFHIGHK
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (77); Rat (80)
Isotype
IgG3 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
POLI monoclonal antibody (M01), clone 8G9. Western Blot analysis of POLI expression in U-2 OS.Western Blot (Transfected lysate)
Western Blot analysis of POLI expression in transfected 293T cell line by POLI monoclonal antibody (M01), clone 8G9.
Lane 1: POLI transfected lysate(80.3 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged POLI is approximately 0.1ng/ml as a capture antibody.ELISA
-
Gene Info — POLI
-
Interactome
-
Disease
-
Publication Reference
-
A Novel Interaction Between RAD23A/B and Y-family DNA Polymerases.
Nicholas W Ashton, Nancy Jaiswal, Natália Cestari Moreno, Irina V Semenova, Dana A D'Orlando, Marcela Teatin Latancia, Justyna McIntyre, Roger Woodgate, Irina Bezsonova.
Journal of Molecular Biology 2023 Dec; 435(24):168353.
Application:Microarray, Human, HEK293T.
-
Both High-fidelity Replicative and Low-fidelity Y-family Polymerases are Involved in DNA Rereplication.
Sekimoto T, Oda T, Kurashima K, Hanaoka F, Yamashita T.
Molecular and Cellular Biology 2015 Feb; 35(4):699.
Application:IF, WB-Ce, Human, U2OS, HCT116 cells.
-
Rev1, Rev3, or Rev7 siRNA Abolishes Ultraviolet Light-Induced Translesion Replication in HeLa Cells: A Comprehensive Study Using Alkaline Sucrose Density Gradient Sedimentation.
Takezawa J, Ishimi Y, Aiba N, Yamada K.
Journal of Nucleic Acids 2010 Dec; 2010:750296.
Application:WB, Human, HeLa cells.
-
Evidence that in xeroderma pigmentosum variant cells, which lack DNA polymerase eta, DNA polymerase iota causes the very high frequency and unique spectrum of UV-induced mutations.
Wang Y, Woodgate R, McManus TP, Mead S, McCormick JJ, Maher VM.
Cancer Research 2007 Apr; 67(7):3018.
Application:WB-Tr, Human, HEK 293.
-
A Novel Interaction Between RAD23A/B and Y-family DNA Polymerases.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com