SUPT16H monoclonal antibody (M01), clone 1D12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SUPT16H.
Immunogen
SUPT16H (NP_009123, 608 a.a. ~ 715 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
PGEQTVPALNLQNAFRIIKEVQKRYKTREAEEKEKEGIVKQDSLVINLNRSNPKLKDLYIRPNIAQKRMQGSLEAHVNGFRFTSVRGDKVDILYNNIKHALFQPCDGE
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.62 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
SUPT16H monoclonal antibody (M01), clone 1D12 Western Blot analysis of SUPT16H expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SUPT16H is 0.03 ng/ml as a capture antibody.ELISA
-
Gene Info — SUPT16H
Entrez GeneID
11198GeneBank Accession#
NM_007192Protein Accession#
NP_009123Gene Name
SUPT16H
Gene Alias
CDC68, FACT, FACTP140, FLJ10857, FLJ14010, FLJ34357, SPT16/CDC68
Gene Description
suppressor of Ty 16 homolog (S. cerevisiae)
Omim ID
605012Gene Ontology
HyperlinkGene Summary
Transcription of protein-coding genes can be reconstituted on naked DNA with only the general transcription factors and RNA polymerase II. However, this minimal system cannot transcribe DNA packaged into chromatin, indicating that accessory factors may facilitate access to DNA. One such factor, FACT (facilitates chromatin transcription), interacts specifically with histones H2A/H2B to effect nucleosome disassembly and transcription elongation. FACT is composed of an 80 kDa subunit and a 140 kDa subunit; this gene encodes the 140 kDa subunit. [provided by RefSeq
Other Designations
chromatin-specific transcription elongation factor large subunit|facilitates chromatin remodeling 140 kDa subunit
-
Interactome
-
Publication Reference
-
Chromatin Trapping of Factors Involved in DNA Replication and Repair Underlies Heat-Induced Radio- And Chemosensitization.
Artem V Luzhin, Bogdan Avanesyan, Artem K Velichko, Victoria O Shender, Natalia Ovsyannikova, Georgij P Arapidi, Polina V Shnaider, Nadezhda V Petrova, Igor I Kireev, Sergey V Razin, Omar L Kantidze.
Cells 2020 Jun; 9(6):1423.
Application:WB-Ce, Human, HeLa cells.
-
Chromatin Trapping of Factors Involved in DNA Replication and Repair Underlies Heat-Induced Radio- And Chemosensitization.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com