NUDT4 monoclonal antibody (M08), clone 2F2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NUDT4 is approximately 3ng/ml as a capture antibody.
Western Blot detection against Immunogen (45.65 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant NUDT4.
Immunogen
NUDT4 (AAH12069, 1 a.a. ~ 181 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MMKFKPNQTRTYDREGFKKRAACLCFRSEQEDEVLLVSSSRYPDQWIVPGGGMEPEEEPGGAAVREVYEEAGVKGKLGRLLGIFEQNQDRKHRTYVYVLTVTEILEDWEDSVNIGRKREWFKVEDAIKVLQCHKPVHAEYLEKLKLGCSPANGNSTVPSLPDNNALFVTAAQTSGLPSSVR
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (96); Rat (95)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (45.65 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NUDT4 is approximately 3ng/ml as a capture antibody.ELISA
-
Gene Info — NUDT4
Entrez GeneID
11163GeneBank Accession#
BC012069Protein Accession#
AAH12069Gene Name
NUDT4
Gene Alias
DIPP2, DIPP2alpha, DIPP2beta, DKFZp686I1281, HDCMB47P, KIAA0487
Gene Description
nudix (nucleoside diphosphate linked moiety X)-type motif 4
Omim ID
609229Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene regulates the turnover of diphosphoinositol polyphosphates. The turnover of these high-energy diphosphoinositol polyphosphates represents a molecular switching activity with important regulatory consequences. Molecular switching by diphosphoinositol polyphosphates may contribute to regulating intracellular trafficking. Several alternatively spliced transcript variants have been described, but the full-length nature of some variants has not been determined. Isoforms DIPP2alpha and DIPP2beta are distinguishable from each other solely by DIPP2beta possessing one additional amino acid due to intron boundary skidding in alternate splicing. [provided by RefSeq
Other Designations
diphosphoinositol polyphosphate phosphohydrolase type 2|nudix-type motif 4
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com