DMC1 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human DMC1 partial ORF ( NP_008999, 237 a.a. - 339 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
GELAERQQKLAQMLSRLQKISEEYNVAVFVTNQMTADPGATMTFQADPKKPIGGHILAHASTTRISLRKGRGELRIAKIYDSPEMPENEATFAITAGGIGDAK
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
37.07
Interspecies Antigen Sequence
Mouse (97); Rat (97)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — DMC1
Entrez GeneID
11144GeneBank Accession#
NM_007068Protein Accession#
NP_008999Gene Name
DMC1
Gene Alias
DMC1H, HsLim15, LIM15, MGC150472, MGC150473, dJ199H16.1
Gene Description
DMC1 dosage suppressor of mck1 homolog, meiosis-specific homologous recombination (yeast)
Omim ID
602721Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is essential for meiotic homologous recombination. Genetic recombination in meiosis plays an important role in generating diversity of genetic information. The product of this gene is structurally and evolutionary related to the products of the yeast RAD51 and E. coli RecA genes. Alternative splice variants of this gene have been described but their full-length nature has not been determined. [provided by RefSeq
Other Designations
DMC1 dosage suppressor of mck1 homolog|DMC1 homologue|disrupted meiotic cDNA1, yeast, homolog of|meiotic recombination protein DMC1/LIM15 homolog
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com