DIDO1 monoclonal antibody (M04), clone 3B1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant DIDO1.
Immunogen
DIDO1 (AAH14489, 321 a.a. ~ 420 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
ILQVQDETHSETADQQEAKWRPGDADGTDCTSIGTIEQKSSEDQGIKGRIEKAANPSGKKKLKIFQPVIEAPGASKCIGPGCCHVAQPDSVYCSNDCILK
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (76)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.41 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
DIDO1 monoclonal antibody (M04), clone 3B1. Western Blot analysis of DIDO1 expression in HepG2(Cat # L019V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged DIDO1 is 0.03 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to DIDO1 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — DIDO1
Entrez GeneID
11083GeneBank Accession#
BC014489Protein Accession#
AAH14489Gene Name
DIDO1
Gene Alias
BYE1, C20orf158, DATF1, DIDO2, DIDO3, DIO-1, DIO1, DKFZp434P1115, FLJ11265, KIAA0333, MGC16140, dJ885L7.8
Gene Description
death inducer-obliterator 1
Omim ID
604140Gene Ontology
HyperlinkGene Summary
Apoptosis, a major form of cell death, is an efficient mechanism for eliminating unwanted cells and is of central importance for development and homeostasis in metazoan animals. In mice, the death inducer-obliterator-1 gene is upregulated by apoptotic signals and encodes a cytoplasmic protein that translocates to the nucleus upon apoptotic signal activation. When overexpressed, the mouse protein induced apoptosis in cell lines growing in vitro. This gene is similar to the mouse gene and therefore is thought to be involved in apoptosis. Alternatively spliced transcripts have been found for this gene, encoding multiple isoforms. [provided by RefSeq
Other Designations
OTTHUMP00000031518|OTTHUMP00000031519|OTTHUMP00000031520|OTTHUMP00000031521|OTTHUMP00000031522|death associated transcription factor 1
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com