VAX1 monoclonal antibody (M03), clone 2F4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant VAX1.
Immunogen
VAX1 (NP_954582.1, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MFGKPDKMDVRCHSDAEAARVSKNAHKESRESKGAEGNLPAAFLKEPQGAFSASGAAEDCNKSKSNSAADPDYCRRILVRDAKGSIREIILPKGLDLDRP
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (86); Rat (86)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
VAX1 monoclonal antibody (M03), clone 2F4. Western Blot analysis of VAX1 expression in HepG2(Cat # L019V1 ).Western Blot (Cell lysate)
VAX1 monoclonal antibody (M03), clone 2F4. Western Blot analysis of VAX1 expression in PC-12(Cat # L012V1 ).Western Blot (Cell lysate)
VAX1 monoclonal antibody (M03), clone 2F4. Western Blot analysis of VAX1 expression in Raw 264.7(Cat # L024V1 ).Western Blot (Cell lysate)
VAX1 monoclonal antibody (M03), clone 2F4. Western Blot analysis of VAX1 expression in NIH/3T3(Cat # L018V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged VAX1 is 0.3 ng/ml as a capture antibody.ELISA
-
Gene Info — VAX1
Entrez GeneID
11023GeneBank Accession#
NM_199131Protein Accession#
NP_954582.1Gene Name
VAX1
Gene Alias
MGC126743, MGC126745
Gene Description
ventral anterior homeobox 1
Omim ID
604294Gene Ontology
HyperlinkGene Summary
This gene encodes a homeo-domain containing protein from a class of homeobox transcription factors which are conserved in vertebrates. Genes of this family are involved in the regulation of body development and morphogenesis. The most conserved genes, called HOX genes are found in special gene clusters. This gene belongs to the VAX subfamily and lies in the vicinity of the EMX homeobox gene family. Another member of VAX family is located on chromosome 2. The encoded protein may play an important role in the development of anterior ventral forebrain and visual system. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000058791|OTTHUMP00000180555
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com