IL24 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human IL24 partial ORF ( AAH09681, 58 a.a. - 167 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
GPCQVKGVVPQKLWEAFWAVKDTMQAQDNITSARLLQQEVLQNVSDAESCYLVHTLLEFYLKTVFKNYHNRTVEVRTLKSFSTLANNFVLIVSQLQPSQENEMFSIRDSA
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
37.73
Interspecies Antigen Sequence
Mouse (66); Rat (63)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — IL24
Entrez GeneID
11009GeneBank Accession#
BC009681Protein Accession#
AAH09681Gene Name
IL24
Gene Alias
C49A, FISP, IL-24, IL10B, MDA7, Mob-5, ST16, mda-7
Gene Description
interleukin 24
Omim ID
604136Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the IL10 family of cytokines. It was identified as a gene induced during terminal differentiation in melanoma cells. The protein encoded by this gene can induce apoptosis selectively in various cancer cells. Overexpression of this gene leads to elevated expression of several GADD family genes, which correlates with the induction of apoptosis. The phosphorylation of mitogen-activated protein kinase 14 (MAPK7/P38), and heat shock 27kDa protein 1 (HSPB2/HSP27) are found to be induced by this gene in melanoma cells, but not in normal immortal melanocytes. Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq
Other Designations
IL-24 splice variant delE3|IL-24 splice variant delE5|OTTHUMP00000034620|melanoma differentiation association protein 7|suppression of tumorigenicity 16 (melanoma differentiation)
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com