SF3B2 monoclonal antibody (M01), clone 5D2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SF3B2.
Immunogen
SF3B2 (NP_006833, 592 a.a. ~ 645 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
YEGKEFETRLKEKKPGDLSDELRISLGMPVGPNAHKVPPPWLIAMQRYGPPPSY
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (98); Rat (98)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (31.68 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
SF3B2 monoclonal antibody (M01), clone 5D2. Western Blot analysis of SF3B2 expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Cell lysate)
SF3B2 monoclonal antibody (M01), clone 5D2 Western Blot analysis of SF3B2 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Cell lysate)
SF3B2 monoclonal antibody (M01), clone 5D2. Western Blot analysis of SF3B2 expression in PC-12 ( Cat # L012V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to SF3B2 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 6 ug/ml]ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to SF3B2 on HeLa cell. [antibody concentration 60 ug/ml] -
Gene Info — SF3B2
Entrez GeneID
10992GeneBank Accession#
NM_006842Protein Accession#
NP_006833Gene Name
SF3B2
Gene Alias
SAP145, SF3B145, SF3b1, SF3b150
Gene Description
splicing factor 3b, subunit 2, 145kDa
Omim ID
605591Gene Ontology
HyperlinkGene Summary
This gene encodes subunit 2 of the splicing factor 3b protein complex. Splicing factor 3b, together with splicing factor 3a and a 12S RNA unit, forms the U2 small nuclear ribonucleoproteins complex (U2 snRNP). The splicing factor 3b/3a complex binds pre-mRNA upstream of the intron's branch site in a sequence-independent manner and may anchor the U2 snRNP to the pre-mRNA. Splicing factor 3b is also a component of the minor U12-type spliceosome. Subunit 2 associates with pre-mRNA upstream of the branch site at the anchoring site. Subunit 2 also interacts directly with subunit 4 of the splicing factor 3b complex. Subunit 2 is a highly hydrophilic protein with a proline-rich N-terminus and a glutamate-rich stretch in the C-terminus. [provided by RefSeq
Other Designations
pre-mRNA splicing factor SF3b 145 kDa subunit|spliceosome associated protein 145|splicing factor 3B subunit 2
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com