RNPS1 monoclonal antibody (M05), clone 7G8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant RNPS1.
Immunogen
RNPS1 (NP_006702, 158 a.a. ~ 239 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
PKPTKVHIGRLTRNVTKDHIMEIFSTYGKIKMIDMPVERMHPHLSKGYAYVEFENPDEAEKALKHMDGGQIDGQEITATAVL
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (100); Rat (99)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (34.76 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
RNPS1 monoclonal antibody (M05), clone 7G8. Western Blot analysis of RNPS1 expression in rat testis.Western Blot (Tissue lysate)
RNPS1 monoclonal antibody (M05), clone 7G8. Western Blot analysis of RNPS1 expression in human kidney.Western Blot (Cell lysate)
RNPS1 monoclonal antibody (M05), clone 7G8. Western Blot analysis of RNPS1 expression in 293.Western Blot (Cell lysate)
RNPS1 monoclonal antibody (M05), clone 7G8. Western Blot analysis of RNPS1 expression in PC-12.Western Blot (Cell lysate)
RNPS1 monoclonal antibody (M05), clone 7G8. Western Blot analysis of RNPS1 expression in Raw 264.7.Western Blot (Cell lysate)
RNPS1 monoclonal antibody (M05), clone 7G8. Western Blot analysis of RNPS1 expression in HeLa.Western Blot (Recombinant protein)
ELISA
-
Gene Info — RNPS1
Entrez GeneID
10921GeneBank Accession#
NM_006711Protein Accession#
NP_006702Gene Name
RNPS1
Gene Alias
E5.1, MGC117332
Gene Description
RNA binding protein S1, serine-rich domain
Omim ID
606447Gene Ontology
HyperlinkGene Summary
This gene encodes a protein that is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. mRNA surveillance detects exported mRNAs with truncated open reading frames and initiates nonsense-mediated mRNA decay (NMD). When translation ends upstream from the last exon-exon junction, this triggers NMD to degrade mRNAs containing premature stop codons. This protein binds to the mRNA and remains bound after nuclear export, acting as a nucleocytoplasmic shuttling protein. This protein contains many serine residues. Two splice variants have been found for this gene; both variants encode the same protein. [provided by RefSeq
Other Designations
RNA-binding protein S1, serine-rich domain|SR protein
-
Interactome
-
Publication Reference
-
Global tumor protein p53/p63 interactome: making a case for cisplatin chemoresistance.
Huang Y, Jeong JS, Okamura J, Sook-Kim M, Zhu H, Guerrero-Preston R, Ratovitski EA.
Cell Cycle 2012 Jun; 11(12):2367.
Application:WB, Human, SCC cell.
-
Global tumor protein p53/p63 interactome: making a case for cisplatin chemoresistance.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com