PPARGC1A polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant PPARGC1A.
Immunogen
PPARGC1A (NP_037393, 689 a.a. ~ 798 a.a) partial recombinant protein with GST tag.
Sequence
TRTELRDRFEVFGEIEECTVNLRDDGDSYGFITYRYTCDAFAALENGYTLRRSNETDFELYFCGRKQFFKSNYADLDSNSDDFDPASTKSKYDSLDFDSLLKEAQRSLRR
Host
Mouse
Interspecies Antigen Sequence
Mouse (94); Rat (95)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (38.21 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
-
Gene Info — PPARGC1A
Entrez GeneID
10891GeneBank Accession#
NM_013261Protein Accession#
NP_037393Gene Name
PPARGC1A
Gene Alias
LEM6, PGC-1(alpha), PGC-1v, PGC1, PGC1A, PPARGC1
Gene Description
peroxisome proliferator-activated receptor gamma, coactivator 1 alpha
Omim ID
604517Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a transcriptional coactivator that regulates the genes involved in energy metabolism. This protein interacts with PPARgamma, which permits the interaction of this protein with multiple transcription factors. This protein can interact with, and regulate the activities of, cAMP response element binding protein (CREB) and nuclear respiratory factors (NRFs). It provides a direct link between external physiological stimuli and the regulation of mitochondrial biogenesis, and is a major factor that regulates muscle fiber type determination. This protein may be also involved in controlling blood pressure, regulating cellular cholesterol homoeostasis, and the development of obesity. [provided by RefSeq
Other Designations
OTTHUMP00000123372|PPAR gamma coactivator variant form|PPAR gamma coactivator-1|ligand effect modulator-6|peroxisome proliferative activated receptor, gamma, coactivator 1, alpha
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com