ALDH1L1 monoclonal antibody (M01), clone 3E9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
ALDH1L1 monoclonal antibody (M01), clone 3E9 Western Blot analysis of ALDH1L1 expression in NIH/3T3 ( Cat # L018V1 ).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to ALDH1L1 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ALDH1L1 is 0.3 ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to ALDH1L1 on NIH/3T3 cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ALDH1L1.
Immunogen
ALDH1L1 (NP_036322, 803 a.a. ~ 902 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
EESFGPVMIISRFADGDLDAVLSRANATEFGLASGVFTRDINKALYVSDKLQAGTVFVNTYNKTDVAAPFGGFKQSGFGKDLGEAALNEYLRVKTVTFEY
Host
Mouse
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (90); Rat (89)
Isotype
IgG3 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
ALDH1L1 monoclonal antibody (M01), clone 3E9 Western Blot analysis of ALDH1L1 expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to ALDH1L1 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ALDH1L1 is 0.3 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to ALDH1L1 on NIH/3T3 cell. [antibody concentration 10 ug/ml] -
Gene Info — ALDH1L1
Entrez GeneID
10840GeneBank Accession#
NM_012190Protein Accession#
NP_036322Gene Name
ALDH1L1
Gene Alias
DKFZp781N0997, FTHFD
Gene Description
aldehyde dehydrogenase 1 family, member L1
Omim ID
600249Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene catalyzes the conversion of 10-formyltetrahydrofolate, NADP, and water to tetrahydrofolate, NADPH, and carbon dioxide. The encoded protein belongs to the aldehyde dehydrogenase family and is responsible for formate oxidation in vivo. Deficiencies in this gene can result in an accumulation of formate and subsequent methanol poisoning. [provided by RefSeq
Other Designations
formyltetrahydrofolate dehydrogenase
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com